PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00022389001
Common NameGSBRNA2T00022389001, LOC106391638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 273aa    MW: 30762.9 Da    PI: 7.8009
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00022389001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.5e-17202247551
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          ++++r++kNRe+A+rsR+RK+a+++eLe kv +Le+eN++L+ +l e
  GSBRNA2T00022389001 202 RKQKRMIKNRESASRSRARKQAYTQELEIKVSSLEEENQKLR-RLME 247
                          689**************************************9.5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-9197254IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.22200247IPR004827Basic-leucine zipper domain
PfamPF001708.0E-14202244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-14202244No hitNo description
SuperFamilySSF579596.88E-11202246No hitNo description
CDDcd147071.08E-19202247No hitNo description
PROSITE patternPS000360205220IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGSLRGNVEE PIHQSLPRQN SLYNLKLHEV QNHLGSSSKP LGSMNLDELL KSVLSAEANH  60
PPEEGTEEGI TRQGSLTLPR GLSIKTVNEV WRDIQHGERL DNPNKQPTLG EITLEDLLMK  120
AGVVTESMTV PQNVVNVASN GQWAQYPQQQ HQGFMPYPVC DMQEMVPPTA LMMGGLSETQ  180
QVHGRKRVAS SEGEFVERIV ERKQKRMIKN RESASRSRAR KQAYTQELEI KVSSLEEENQ  240
KLRRLMEVEK ILPSEPPPEP KWKLRRTSTA SF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00022389001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3342092e-80AF334209.1 Arabidopsis thaliana bZIP protein DPBF4 mRNA, complete cds.
GenBankAJ4208812e-80AJ420881.1 Arabidopsis thaliana partial mRNA for basic leucine zipper transcription factor (atbzip12 gene).
GenBankAY0846682e-80AY084668.1 Arabidopsis thaliana clone 114632 mRNA, complete sequence.
GenBankBT0251752e-80BT025175.1 Arabidopsis thaliana At2g41070 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687784.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 3
RefseqXP_013687785.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 3
RefseqXP_013687786.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 3
SwissprotQ9C5Q21e-131AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLA0A078J2900.0A0A078J290_BRANA; BnaC04g56840D protein
STRINGBra016953.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.31e-133bZIP family protein
Publications ? help Back to Top
  1. Haas BJ, et al.
    Full-length messenger RNA sequences greatly improve genome annotation.
    Genome Biol., 2002. 3(6): p. RESEARCH0029
    [PMID:12093376]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  4. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]