PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00021828001
Common NameGSBRNA2T00021828001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 458aa    MW: 49730.3 Da    PI: 7.5348
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00021828001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.44e-25162218259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H he
  GSBRNA2T00021828001 162 RDGYHWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGSHSHE 218
                          7********************************98.*********************8 PP

2WRKY97.39.8e-31322378359
                          -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          Dgy+WrKYGqK+vkg+++pr+YYrCtsagC+v+k++e++ e+ ++v+itY+g Hnh+
  GSBRNA2T00021828001 322 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCSVRKHIETALENRTAVVITYKGVHNHD 378
                          9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-19158219IPR003657WRKY domain
SuperFamilySSF1182904.45E-19160218IPR003657WRKY domain
SMARTSM007741.3E-22161219IPR003657WRKY domain
PfamPF031065.4E-17163217IPR003657WRKY domain
PROSITE profilePS5081115.078163220IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-31305380IPR003657WRKY domain
PROSITE profilePS5081131.686315380IPR003657WRKY domain
SuperFamilySSF1182902.22E-26316380IPR003657WRKY domain
SMARTSM007741.0E-33320379IPR003657WRKY domain
PfamPF031065.9E-23322378IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MDDKDSGEAD VYAAAETEKG EKVEPEKELC HGDDDGLSQL RGEESPVRET LAKDHDEDVR  60
ENSSVEPNRE DVKERDRGSG KESVVSAIVP VDEVAVENHV VEPSTSMTVL INPSMVEASL  120
SSNPSAAQGV SPVSVPSKRE QRSDSRVVSN LSVSPVLRRP ARDGYHWRKY GQKQVKSPKG  180
SRSYYRCTYS DCCAKKIECS NDSGNVIEIV NKGSHSHEPL RKNSFSPRET RAASDRPCME  240
DNTVVPTGSA LSISTKENVC QSLAIVEGKR NCENEAVEEP EPKRRQVLLK KSNSQSSDSV  300
SKPGKKHKVV VHAAGDVGIS GDGYRWRKYG QKMVKGNPNP RNYYRCTSAG CSVRKHIETA  360
LENRTAVVIT YKGVHNHDMP VPKKHHGPPS SALVAAAAPT SMRTRLEDQV NIPTSGHSSV  420
GGGSDKQNSE AVDVGGGEKV MESARTLLSI GFEIKQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-25311380877Probable WRKY transcription factor 4
1wj2_A5e-25311380877Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00021828001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300490.0KF430049.1 Brassica rapa WRKY transcription factor 32 (WRKY32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108959.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A078GA070.0A0A078GA07_BRANA; BnaA08g12810D protein
STRINGBra010266.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]