PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00021514001
Common NameGSBRNA2T00021514001, LOC106400049, LOC106409743
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 317aa    MW: 34773.1 Da    PI: 9.2539
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00021514001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-14104149247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++WT+eE+ +++ + k+lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
  GSBRNA2T00021514001 104 KPWTEEEHRIFLVGLKELGKGDWRGIAKNFVTTRTPTQVASHAQKY 149
                          58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.13798154IPR017930Myb domain
SuperFamilySSF466898.97E-17100154IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-16101152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.2E-12102148IPR009057Homeodomain-like
SMARTSM007175.9E-12102152IPR001005SANT/Myb domain
PfamPF002492.7E-12104149IPR001005SANT/Myb domain
CDDcd001673.34E-10105150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MVTTGKTCSH CGHNGHNAPT CLNGVNKGSV KLFGVNISSD PIRSPEVTEL RKSVSLGNLD  60
ALLANDNSNG NGDPIAAVED NGYHSDGQIH SKTGRSAHEK KKGKPWTEEE HRIFLVGLKE  120
LGKGDWRGIA KNFVTTRTPT QVASHAQKYF LRLNANDKKR RRASLFDISL EDQNSQVMTT  180
DASTSLSKNP SRQSITGSQE PVQVQTQAEI SNRFQNLSME HMPIYPTVQP YYNFPSVMIH  240
PMYYYPNPEH VRYVHPSGIP VPRPLPIGMP HQANDASRIA KKDGMELDIG LRPPPPPPPQ  300
ATAETDLAGH GVIHVK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00021514001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596262.10.0PREDICTED: transcription factor MYB1R1
RefseqXP_013596263.10.0PREDICTED: transcription factor MYB1R1
RefseqXP_013695921.10.0PREDICTED: transcription factor MYB1R1-like
RefseqXP_013705763.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A078GCL60.0A0A078GCL6_BRANA; BnaC07g31380D protein
TrEMBLA0A0D3DDN70.0A0A0D3DDN7_BRAOL; Uncharacterized protein
STRINGBra012936.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-149MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]