PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00021137001
Common NameGSBRNA2T00021137001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 445aa    MW: 49988.3 Da    PI: 6.4406
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00021137001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS506.31.2e-154534411374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl+cA++v+sg+l++a+a+L++ls l+spdgd+mqR+aayfteALa+r+++s+++lykal++++ +++n+see+++++lf++++Pi
  GSBRNA2T00021137001  53 LIHLLLTCANHVASGNLQNANAALEQLSLLSSPDGDTMQRVAAYFTEALANRILKSWPGLYKALNATQRKTSNVSEEVHVRRLFFDMFPI 142
                          689*************************************************************************************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          lk+s+l++N+aIlea+ege++vH+iD+d+ +++QW+aL+q ++sRpegpp+lRiT v++    +ke l ++++rL++ Ae+l++pf+fn+
  GSBRNA2T00021137001 143 LKVSYLLTNRAILEAMEGEKMVHVIDLDACEPAQWLALIQDFNSRPEGPPHLRITCVHR----HKEVLDQMAHRLTEEAEKLDIPFQFNP 228
                          ***********************************************************....9************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrll..................desvsles..erdevLklvkslsPkvvvvveqeadhns 250
                           v++++e+l++++Lrvk+gEalaV++vlqlh++l                  ++s++l+s  ++d++L+ ++slsPk++vv+eq++dhn+
  GSBRNA2T00021137001 229 -VVSSVESLNIDQLRVKTGEALAVSSVLQLHNFLasdddilrkngcslsgdsASSLPLPSsgRIDRFLNSMWSLSPKIMVVTEQDSDHNG 317
                          .7999*********************************************9977777777779*************************** PP

                 GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                          ++++er+le+l++y+alfd+leak+pr+ ++rikvE++++g+ei+n++aceg+er+erhe+lekW++r++ aGF++vpls++a+ q ++l
  GSBRNA2T00021137001 318 STLMERLLESLYTYAALFDCLEAKVPRTWQDRIKVEKMFFGEEIKNIIACEGSERKERHEKLEKWSKRIDLAGFGNVPLSYFAMLQGRRL 407
                          ****************************************************************************************** PP

                 GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          l+ +++dgy+++eesg++v++W+drpL+svSaWr
  GSBRNA2T00021137001 408 LQGYGFDGYMIKEESGCAVICWQDRPLYSVSAWR 441
                          *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.37427421IPR005202Transcription factor GRAS
PfamPF035144.2E-15253441IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MVVAMLQEDN GTSSVASSPL QVFSTMSLTR PALLSSPSSP FKDLKPEERG LYLIHLLLTC  60
ANHVASGNLQ NANAALEQLS LLSSPDGDTM QRVAAYFTEA LANRILKSWP GLYKALNATQ  120
RKTSNVSEEV HVRRLFFDMF PILKVSYLLT NRAILEAMEG EKMVHVIDLD ACEPAQWLAL  180
IQDFNSRPEG PPHLRITCVH RHKEVLDQMA HRLTEEAEKL DIPFQFNPVV SSVESLNIDQ  240
LRVKTGEALA VSSVLQLHNF LASDDDILRK NGCSLSGDSA SSLPLPSSGR IDRFLNSMWS  300
LSPKIMVVTE QDSDHNGSTL MERLLESLYT YAALFDCLEA KVPRTWQDRI KVEKMFFGEE  360
IKNIIACEGS ERKERHEKLE KWSKRIDLAG FGNVPLSYFA MLQGRRLLQG YGFDGYMIKE  420
ESGCAVICWQ DRPLYSVSAW RCRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-44534414375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00021137001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893010.0AC189301.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030D08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147840.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A078G8L90.0A0A078G8L9_BRANA; BnaA06g02820D protein
STRINGBra018848.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40982759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]