PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00019386001
Common NameGSBRNA2T00019386001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 192aa    MW: 21384.6 Da    PI: 5.8185
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00019386001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42321311100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r+da++slvyeAear+rdPvyG++g i +lq+q+++l
  GSBRNA2T00019386001  32 PCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHRVFGASNIIKLLQELPESQRTDAVKSLVYEAEARIRDPVYGSAGAIYNLQRQVSEL 121
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +aela+++ e
  GSBRNA2T00019386001 122 QAELAKAQVE 131
                          *****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.41731132IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-4232129IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MLDMETKGDA SAAIIYASPA SSPPPPRVVL SPCAACKILR RRCGEKCVLA PYFPPTEPAK  60
FSIAHRVFGA SNIIKLLQEL PESQRTDAVK SLVYEAEARI RDPVYGSAGA IYNLQRQVSE  120
LQAELAKAQV EIVSMQFQRS NLLELINNMD QPNQDQHKMM AFEKSNDFGF LEDKYFNTNS  180
LMLWCDPLLT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-423113310112LOB family transfactor Ramosa2.1
5ly0_B1e-423113310112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.244763e-64leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00019386001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694013.11e-134LOB domain-containing protein 1-like
SwissprotQ9LQR01e-95LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A078GDJ41e-140A0A078GDJ4_BRANA; BnaC08g43470D protein
STRINGBo8g112780.11e-127(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-96LOB domain-containing protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]