PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00019164001
Common NameGSBRNA2T00019164001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 269aa    MW: 30652 Da    PI: 7.3268
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00019164001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.3e-11142185548
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                          kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  GSBRNA2T00019164001 142 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQSEVSVLSPR 185
                          8999********************************98777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-13138202IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.657140192IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.18E-11142196No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-11142193No hitNo description
PfamPF001705.7E-9142186IPR004827Basic-leucine zipper domain
CDDcd147031.11E-21143193No hitNo description
PROSITE patternPS000360145160IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAQLPPQIPN MTPHWPDFSQ KLSHFSTAAA SSAFLDFSAC SRGNHRRSIS DSIAFLEAPI  60
VTSHMEEHNF DKFDDEQFMS MFTEDDDDLR NNRSHNNKNV GPNNNNNRND EVRSQCKTEP  120
EDGTASSNNS GDSSSNRIID PKRVKRILAN RQSAQRSRVR KLQYISELER SVTSLQSEVS  180
VLSPRVAFLD HQRLLLNVDN SALKQRIAAL AQDKIFKDAH QESLKREIER LRQVYQQQSF  240
KKMENANHSP ETGVDIKLSI EKEQMLNI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, stems and siliques, anthers, filaments, tapetum, mature pollen grains, pistil vascular tissues and papillar cells, and funiculi. {ECO:0000269|PubMed:19449183}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269|PubMed:17719007, ECO:0000269|PubMed:19449183}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00019164001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0746571e-146AY074657.1 Arabidopsis thaliana At2g42380/MHK10.10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683759.11e-179basic leucine zipper 34-like
SwissprotF4IN231e-134BZP34_ARATH; Basic leucine zipper 34
TrEMBLA0A078GB350.0A0A078GB35_BRANA; BnaC03g23710D protein
STRINGXP_006294608.11e-139(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-115bZIP family protein
Publications ? help Back to Top
  1. Jiang J,Zhang Z,Cao J
    Pollen wall development: the associated enzymes and metabolic pathways.
    Plant Biol (Stuttg), 2013. 15(2): p. 249-63
    [PMID:23252839]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]