PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00018899001
Common NameGSBRNA2T00018899001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 446aa    MW: 49207.6 Da    PI: 7.7867
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00018899001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.4e-10299357563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  GSBRNA2T00018899001 299 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTNQN 357
                          899******************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-19295359IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76297360IPR004827Basic-leucine zipper domain
PfamPF001709.9E-9299356IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-11299355No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-11299356No hitNo description
CDDcd147036.90E-24300349No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MGDTDTDMIH RHHSSIPKQK HQQLELNPNN LIRSSASQFS SESGISKRVG VPPTSPYSQI  60
QILNPGATTT TSHSRSMSQP CSFFSLDSLP PLSPSPFLDD RLNTNPSSLL PPFTSSSRAD  120
SLPPRKSHRR SNSDIPTGLT SNPFVKKEDM DDLFSAYMNL DNIDALNSSE NLSRDDMESS  180
RASGTKTNSD TEGETSSVNG DHNNNNLKRR AGGGDIAPSS RHYRSVSVDS CFIDKLSFPD  240
DSLKPPPSPG TTRKVSPTNS VDAAPAFSIE FNNGEFTAAE MKKIMANDKL ADMAISDPKR  300
VKRILANRQS AARSKERKMR YIVELEHKVQ TLQTEATTLS AQLTLLQRDM MGLTNQNNEL  360
KFRLQSMEQQ ARLRDALNEA LNGEVQRLKL AIGESSHSNE ADRSKMQSLN AEMFQQLNIS  420
QLRQQQPQSQ SLQNGTVSTK PESNE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00018899001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808390.0AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504350.0AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013644909.10.0transcription factor VIP1-like
RefseqXP_013644910.10.0transcription factor VIP1-like
TrEMBLA0A078GBF30.0A0A078GBF3_BRANA; BnaA06g37290D protein
STRINGBra033582.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-169bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]