PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00018780001
Common NameGSBRNA2T00018780001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 267aa    MW: 29795.5 Da    PI: 5.5429
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00018780001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.31.2e-16182241261
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          ++ +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L  e+ee +ke ++  +
  GSBRNA2T00018780001 182 AAAQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEEENEKLSVEIEEKRKERYQKLM 241
                          5789**********************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-13179236No hitNo description
SMARTSM003381.1E-11181245IPR004827Basic-leucine zipper domain
PfamPF001708.5E-16182242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.3183235IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.06E-10185237No hitNo description
CDDcd147071.72E-18185231No hitNo description
PROSITE patternPS000360188203IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MASFKVMHSP SSTNSDPSRR IPSSSIRPRR DPNARILGGY DGYSPAAMTV EGILHETFAS  60
DPPATDSSLL MDASPTATVS GGTDTRGKSV DEVWRGMKEE EEMMTLEDFL AKATGEDGGG  120
ESDDVDVKIP PAESYGFDHH NPFQMIDKVE GSIVAFGNGV DVYGGGARGK RARVMMEPLD  180
KAAAQRQRRM IKNRESAARS RERKQAYQVE LETLAAKLEE ENEKLSVEIE EKRKERYQKL  240
MEFVIPVVER PKQEPRFLRR IRSLEW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.15780.0leaf| microspore-derived embryo| seed
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00018780001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894020.0AC189402.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB057L05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022547960.10.0G-box-binding factor 4-like isoform X1
SwissprotP427771e-63GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A078GA920.0A0A078GA92_BRANA; BnaA06g36330D protein
STRINGBra033719.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.13e-99bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]