PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00018451001
Common NameGSBRNA2T00018451001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 396aa    MW: 43406.9 Da    PI: 5.1991
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00018451001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.96.1e-15198251356
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                          ++k+ rr+ +NRe+ArrsR+RK++++  Le+ v eL++e ++L k+l++++ ++
  GSBRNA2T00018451001 198 DVKKSRRMLSNRESARRSRRRKQEQTCDLETQVNELKGEHSSLLKQLSNMNHKY 251
                          789*****************************************9888887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-19196260IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-12197250No hitNo description
PfamPF001703.1E-14198252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944198252IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-11199250No hitNo description
PROSITE patternPS000360203218IPR004827Basic-leucine zipper domain
PfamPF124981.2E-12267357IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MNSIFSIDDF SDPFWESSPP LDSDSAKALT AEEWTVEMFF EEIASSVTSA PVGSNNNNNN  60
AIVGVSSAQS LPSVSGQNDF EEDSRFLRRE SDDYRRVLEN KLETECAATV VALRAGSVKP  120
EDSTGSPETL FQPALSSPLT QGSLVTPGEV GVTSSLLAEV KKTGVPMKQV TSGSSRDYSD  180
DDDLDEENET TGSLKPEDVK KSRRMLSNRE SARRSRRRKQ EQTCDLETQV NELKGEHSSL  240
LKQLSNMNHK YDDAAVGNRI LKADIETLRA KVKMAEETVK RVTGMNPMLL GRSNGHNNNN  300
NRMPLTGNSR MGGSSCIPPF QPQSNPNMGG LTTTILSPRL ENSFIPTPSL NSQTNSPHLQ  360
RIRPTQNHHA APTTNTYGWT TETHNDSAWP KKCVD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212219RRSRRRKQ
2214219SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.75240.0flower| microspore-derived embryo| seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First observed in carpels and seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, trichomes, hydathodes, siliques, seeds, and flowers, mostly in vascular tissues. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters. Binds to the 5'-ACGT-3' motif of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. Involved in the defense responses to the biotrophic pathogen Hyaloperonospora parasitica and oxidative stress responses; mediates positively cell death (PubMed:12657652, PubMed:16957775, PubMed:19261733, PubMed:19531597). Promotes BZIP53-mediated response to hypoosmolarity stress that leads to POX1/PRODH1 accumulation (PubMed:16810321). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:16957775, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00018451001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111266.10.0PREDICTED: basic leucine zipper 10
RefseqXP_013722933.10.0basic leucine zipper 10-like
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLA0A078G9P90.0A0A078G9P9_BRANA; BnaA09g00980D protein
STRINGBra036251.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.20.0bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]