PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00017381001
Common NameGSBRNA2T00017381001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 316aa    MW: 34952.6 Da    PI: 9.2763
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00017381001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.16e-16152208359
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                          ++kr+rr+ +NRe+ArrsR+RK++++ e  + v +L +e ++L ++l+ ++ ++++ 
  GSBRNA2T00017381001 152 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRGEHSTLLSRLSDMNHKCDAA 208
                          68*********************************************9999999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-16150214IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-11151206No hitNo description
PROSITE profilePS5021710.519152204IPR004827Basic-leucine zipper domain
PfamPF001702.4E-13153206IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-10154203No hitNo description
PROSITE patternPS000360157172IPR004827Basic-leucine zipper domain
PfamPF124982.5E-12221291IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTRSQSEWAF QRLLKENSGS DQTNAIDRLS PPVQSLSTVD ETGDVVEIQK PPRNHQGSRK  60
QQARSCLRRR VGTVEPEDSS ASSSVNQNQS QPPQGSVVAQ TSPGASSVRS VPSTSIQKKL  120
DVPARQATSI SSRDDSDDDD LDGDADNGDP TDVKRARRML SNRESARRSR RRKQEQMNEF  180
DTQVGQLRGE HSTLLSRLSD MNHKCDAAAV DNRILRADIE TLRTKVKMVE ETVKRVTGVN  240
PLHWARPNMG TPLNNTPIDS SRILPNSNHM LEPAIPSTTN AGLASNQRVE RANLLLEQVN  300
REGMQNQFAI NPNLY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166173RRSRRRKQ
2168173SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.211111e-104leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First observed in seeds at early stages of development, mostly in embryo and, at lower extent, in the endosperm. Accumulates and peaks at maturation. Fade out during late seed development steps, restricted to the inner layer of the seed coat, and, at very low levels, in the mature embryo and the remaining endosperm. Also present in the lignified inner subepidermal layer of the valves. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, leaves, stipulae, siliques, seeds, pollen, and flowers. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00017381001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0575090.0AY057509.1 Arabidopsis thaliana bZIP transcription factor-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403555.11e-138basic leucine zipper 25 isoform X1
SwissprotQ9M1G61e-131BZP25_ARATH; Basic leucine zipper 25
TrEMBLA0A078IW330.0A0A078IW33_BRANA; BnaCnng29250D protein
STRINGBo4g119810.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.11e-121basic leucine zipper 25
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  5. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]