PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00017285001
Common NameGSBRNA2T00017285001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 522aa    MW: 59731.9 Da    PI: 8.8434
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00017285001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS51.22.3e-16180244165
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalp 65 
                          l++lL++cA+avss+d ++a+ lL ++++++s++gd ++Rla+y++  L+arla++++++y a+ 
  GSBRNA2T00017285001 180 LRTLLVSCAQAVSSNDRKMAEDLLRQVRQHSSSHGDGTERLAHYLADSLEARLAGTGTQIYTAFI 244
                          6789*********************************************************9875 PP

2GRAS267.54.5e-82251516108371
                 GRAS 108 geervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                           ++++HiiDf+is+G+QWp+L++ La R++g+ +lRiTg++ p+ g   +e ++etgerLa+++++ +vpfe+n  +a+++e+++le+L+
  GSBRNA2T00017285001 251 DAKTIHIIDFGISYGFQWPPLIHRLAWRRGGSCKLRITGIELPQRGfrPAEGVNETGERLARYCQRYNVPFEYNG-IAQKWETIKLEDLK 339
                          4689****************************************99*****************************.7************* PP

                 GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                          +++gE +aVn+ ++  +llde+v+++s+rd+vLkl+k+++P+v++ +     +n++ F++rf e l +ys+lfd+ +++lpr +  ri+ 
  GSBRNA2T00017285001 340 LREGEFVAVNSLFRFRNLLDETVAVHSPRDAVLKLIKKIKPDVFIPAVLSGCYNAPFFVTRFREVLFHYSSLFDMCDTSLPRGDPMRIMF 429
                          ****************************************************************************************** PP

                 GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvS 371
                          E+e+ grei+nvvaceg+er+er e++++W++r ++aGF++++l+++ +++ kl+++  + s+++ v+++ ++l++gWk+r +++ +
  GSBRNA2T00017285001 430 EKEFYGREIMNVVACEGSERVERPESYKQWQARAMRAGFRQLTLEKELVQKLKLMVESGYrSKEFDVDQDGNWLLQGWKGRIVYASC 516
                          *********************************************************99999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.97154498IPR005202Transcription factor GRAS
PfamPF035148.1E-14180244IPR005202Transcription factor GRAS
PfamPF035141.6E-79251516IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
FDCLENNRPS WLHSPISNNF VFQSTRSNPK PSGGSNVALK SSFNNDLVSN MFNDSELAFQ  60
FKRGKEEASK FLPKSSQLEH PSVLPYRRTG KKKHWREDEH LVFEERSKKQ SAVYVDEAEL  120
SEMFDKILLF GRPKEQPLCI LNDNFIKETA KDSSSSYKSD ATQQKHAASG NSYAKETPDL  180
RTLLVSCAQA VSSNDRKMAE DLLRQVRQHS SSHGDGTERL AHYLADSLEA RLAGTGTQIY  240
TAFIMHLAPT DAKTIHIIDF GISYGFQWPP LIHRLAWRRG GSCKLRITGI ELPQRGFRPA  300
EGVNETGERL ARYCQRYNVP FEYNGIAQKW ETIKLEDLKL REGEFVAVNS LFRFRNLLDE  360
TVAVHSPRDA VLKLIKKIKP DVFIPAVLSG CYNAPFFVTR FREVLFHYSS LFDMCDTSLP  420
RGDPMRIMFE KEFYGREIMN VVACEGSERV ERPESYKQWQ ARAMRAGFRQ LTLEKELVQK  480
LKLMVESGYR SKEFDVDQDG NWLLQGWKGR IVYASCTLVP T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-331774732328GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18692RRTGKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.172313e-76seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636977.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_013636978.10.0PREDICTED: scarecrow-like protein 33
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLA0A078JVG40.0A0A078JVG4_BRANA; BnaCnng73510D protein (Fragment)
STRINGBra028390.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]