PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00017146001
Common NameGSBRNA2T00017146001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TCP
Protein Properties Length: 383aa    MW: 41979.5 Da    PI: 7.4662
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00017146001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP115.66.4e-36541882136
                  TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 
                           g+kdrhsk+ T++g+RdRRvRls+++a +f+dLqd+LG+d++sk++eWL+++a+ +i el+++ ++++  +++++++  + +  s+ aa
  GSBRNA2T00017146001  54 SGGKDRHSKVWTSKGPRDRRVRLSVSTALQFYDLQDRLGYDQPSKAVEWLIKAAEDSISELPSL-NNTNFPMNDDDNQIPTLTGASPTAA 142
                          689*************************************************************.4444344333333333333333333 PP

                  TCP  92 ksaa.kskksqksaasalnlakesr..akarararertrekmriknkl 136
                          ++aa + +ks  s+  +++ +k+s+  + +r+rarert+++ + ++ +
  GSBRNA2T00017146001 143 AAAAnSLSKSACSS--NSDTSKNSSglSLSRERARERTAKETKERDGN 188
                          33321223333333..34444444444666666666666665555433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.7E-3655184IPR005333Transcription factor, TCP
PROSITE profilePS5136931.22956114IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVIEKLRNES IGDDEMIGDL MKNNNGDVVD NTNNNRLSRW HHNSSRIIRV SRASGGKDRH  60
SKVWTSKGPR DRRVRLSVST ALQFYDLQDR LGYDQPSKAV EWLIKAAEDS ISELPSLNNT  120
NFPMNDDDNQ IPTLTGASPT AAAAAANSLS KSACSSNSDT SKNSSGLSLS RERARERTAK  180
ETKERDGNNN HHTTSFTDLL NSGSDPVNTN RQWMAPSSSP APMEYFSSGL ILGSGQTHFP  240
IQTNSHPFSS ISDHHHQHHP HQEFSFVPDH LISPAGSNGG GAFNLDFNMS TTSVASTGFS  300
GFNRGTLQSN STNHHHHHQS FLANLQRFPS SEGGGGPQFL FGTGALPAEN QHPHHNNNNN  360
HQFQLYYENG CRNSDQKGKG KN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A7e-2461115155Putative transcription factor PCF6
5zkt_B7e-2461115155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.166451e-168root
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During flower development, first observed throughout the floral meristem. Later expressed in rapidly growing floral primordia. Detected to a lower extent in vegetative primordia. During flower development, first observed throughout the floral meristem. Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:10363373, ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, buds, flowers and immature siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00017146001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895530.0AC189553.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006A08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599182.10.0PREDICTED: transcription factor TCP2-like
SwissprotQ93V430.0TCP2_ARATH; Transcription factor TCP2
TrEMBLA0A078J1D40.0A0A078J1D4_BRANA; BnaA03g58260D protein
STRINGBo7g105960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM76152539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.21e-136TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]