PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00016178001
Common NameGSBRNA2T00016178001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 271aa    MW: 29655.9 Da    PI: 9.1009
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00016178001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.47e-1387131347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+ E+++++ + ++ G+g Wk I+r + k+Rt+ q+ s+ qky
  GSBRNA2T00016178001  87 AWTESEHKRFLLGLQRVGKGGWKGISRDFVKTRTPTQVASHAQKY 131
                          7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.90180136IPR017930Myb domain
SuperFamilySSF466891.17E-1582136IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-1683134IPR006447Myb domain, plants
SMARTSM007171.4E-684134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-886131IPR009057Homeodomain-like
CDDcd001672.04E-687132No hitNo description
PfamPF002491.1E-987131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MAAVSSSSET GGGAAGKGEI MLFGVRVVVD PMRKCVSLNN LSDYDKSSPE EENEPDAITA  60
AGYASANDAV QITPSTVGNR ERKRGVAWTE SEHKRFLLGL QRVGKGGWKG ISRDFVKTRT  120
PTQVASHAQK YFLRRTNLNR RRRRSSLFDI TTETVIGMHM EQDHAQENSS LPETNISSGH  180
QVMQVFPTRT EENAPQTFHP NDLSSNRVHP VPVTFQANPA FNLNTDAAPV SLNLSLSFNL  240
NEPSNSRRSA FTMMPSFSDG DSNSNTIRVA *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00016178001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530761e-156AK353076.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-16-O16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117571.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B08e-55MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A078G8H30.0A0A078G8H3_BRANA; BnaA09g44370D protein
STRINGBra031060.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-110MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]