PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014689001
Common NameGSBRNA2T00014689001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 550aa    MW: 60174 Da    PI: 8.0324
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014689001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.4e-16278316240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCk+skClk+YCeCfaag++C   C+C dC+Nk 
  GSBRNA2T00014689001 278 SCKRCNCKRSKCLKLYCECFAAGVYCIGPCSCVDCFNKP 316
                          689**********************************96 PP

2TCR52.51e-16364402139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  GSBRNA2T00014689001 364 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 402
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-18277318IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.385278404IPR005172CRC domain
PfamPF036389.3E-12280315IPR005172CRC domain
SMARTSM011144.2E-17364405IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.9E-12366402IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MDTPPKNVTQ MENPISKLKL ENSPVFNYIN SLSPIKPVRS LPIAQTFGSL SYSSPPSVFT  60
SPHVSSHKGS RFKSDHNHVP TSVGEDEALR ETEPPQILQN ECTTDLLKMC DGNVKQKSET  120
PDWDAMISDS SDILILDSVN DSEASRCFLE RPSDSKTRSL GVAKSTLEPL MNIDDALHRG  180
VRRRCLGFEQ TPVASSSRCA VPSIGLHFNT IAMSSNDNNV GNEYSLSGNI KVGLQSSITS  240
VLNSQDNVGV SETGEDAGQG VEEGPKRKFG QAGEGESSCK RCNCKRSKCL KLYCECFAAG  300
VYCIGPCSCV DCFNKPIHED TVMATRKQIE SRNPLAFAPK VIGNSDSIME VGDDAKSKTP  360
ASARHKRGCN CKKSNCLKKY CECYQSGVGC SINCRCEGCK NAFGRKDGSS FTSMDKENET  420
SSRGRTEKQP STPMPLRQPL AQLPISSNNM LLTHQHLHGA SGSSLHMSQS FRRQDMSLMS  480
HSKIEIITEE RRADNIENLI ESPMTNMINA VSPNSKRVSL PMELSPWRRN GGRKLLLSIP  540
TFPSLTPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1628040112120Protein lin-54 homolog
5fd3_B1e-1628040112120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00014689001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-141AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-141AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-141AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584927.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
RefseqXP_013695714.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A078IXG00.0A0A078IXG0_BRANA; BnaCnng27640D protein
STRINGBo5g094510.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]