PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014500001
Common NameGSBRNA2T00014500001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 181aa    MW: 20423.2 Da    PI: 6.9918
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014500001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.2e-3971061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++ Cv+apyfp ++++++a++hk+FGas+v+k+l++l++++r+da++slvyeA+  + dPv+G+  ++ +lq+ql+ l
  GSBRNA2T00014500001   7 PCAACKYLRRKCTQACVFAPYFPPNKQEDYAAIHKVFGASQVTKILNDLHPSQRQDAVTSLVYEAQTLLLDPVHGCSPHVYNLQRQLKDL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +l+ +++e
  GSBRNA2T00014500001  97 QDQLHIARNE 106
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.1996107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-387104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEKMSTPCAA CKYLRRKCTQ ACVFAPYFPP NKQEDYAAIH KVFGASQVTK ILNDLHPSQR  60
QDAVTSLVYE AQTLLLDPVH GCSPHVYNLQ RQLKDLQDQL HIARNELASY NNIVPPLDLP  120
PPITYQQNHH NPMLMPVVSN YDGPLTQQLH EEAHRVESER SAQVQQMQPN AAPSKRDDCP  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-3951109114LOB family transfactor Ramosa2.1
5ly0_B8e-3951109114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00014500001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594297.11e-129PREDICTED: LOB domain-containing protein 28
RefseqXP_013730640.11e-129LOB domain-containing protein 28-like
SwissprotQ9SCS43e-57LBD28_ARATH; LOB domain-containing protein 28
TrEMBLA0A078IX901e-130A0A078IX90_BRANA; BnaC01g42240D protein
TrEMBLA0A0D3A9Q71e-130A0A0D3A9Q7_BRAOL; Uncharacterized protein
TrEMBLA0A3P6FCI41e-130A0A3P6FCI4_BRAOL; Uncharacterized protein
STRINGBo1g084820.11e-131(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.14e-52LOB domain-containing protein 28
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]