PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014148001
Common NameGSBRNA2T00014148001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 287aa    MW: 32027 Da    PI: 5.1998
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014148001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1513.1e-16202261261
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          ++ +r+rr++kNRe+A rsR+RK+a++ eLe+ ++ Le+eN++L  e+ee +ke ++  +
  GSBRNA2T00014148001 202 AAAQRQRRMIKNRESAARSRERKQAYQVELETLAARLEEENEKLSVEIEEKRKERYQKLM 261
                          5789**********************************************9999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.9E-14199256No hitNo description
SMARTSM003381.0E-11201265IPR004827Basic-leucine zipper domain
PfamPF001701.6E-15202262IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.277203255IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10205257No hitNo description
CDDcd147074.89E-19205251No hitNo description
PROSITE patternPS000360208223IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MASFKVMHSS TSTNSDPSRR IPSSSIRPQP FRRDPNARIL GGYDGYSPGT MTVEGILHET  60
FASDPPATDS SLLMDAAPTP MEVATVSGGT DTRGKSVDEV WREIVSGEGK GMKEEAETQH  120
DEMMTLEDFL AKATCEDGGG ESDDVDVKIP PESYGFDHHN PFQMIDKVEG SIVAFGNGVD  180
VYGGGGARGK RARVMMEPLD KAAAQRQRRM IKNRESAARS RERKQAYQVE LETLAARLEE  240
ENEKLSVEIE EKRKERYQKL MEFLIPVVEK PKQEPRFLRR IRSLEW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.15780.0leaf| microspore-derived embryo| seed
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00014148001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894020.0AC189402.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB057L05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706430.10.0G-box-binding factor 4-like
SwissprotP427773e-71GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A078ITJ70.0A0A078ITJ7_BRANA; BnaCnng27030D protein
STRINGBo7g067030.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-91bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]