PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00013267001
Common NameGSBRNA2T00013267001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 171aa    MW: 18633.7 Da    PI: 5.2142
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00013267001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1408.4e-132784562
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                         ++ +r+ +NRe+ArrsR RK++ i+ L+  + +L++ N++    l   ++++ k ++e
  GSBRNA2T00013267001 27 RKRKRMLSNRESARRSRMRKQKHIDDLTAQINQLSSDNRQILTSLTVTSQLYMKIQAE 84
                         57899*********************************99887777777777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-162387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1852588IPR004827Basic-leucine zipper domain
PfamPF001708.7E-102777IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.92E-122778No hitNo description
Gene3DG3DSA:1.20.5.1707.4E-102799No hitNo description
CDDcd147027.74E-222879No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGGNPN AVAVDERKRK RMLSNRESAR RSRMRKQKHI DDLTAQINQL  60
SSDNRQILTS LTVTSQLYMK IQAENSILTA QMAELSSRLE SLNEIVDLVT TTNGAGFGGG  120
VDMIDGCGFD DRTVGINSDG FYDDMMSGVN HWGGSVYSNQ PIMANDINMY *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12647RKRKRMLSNRESARRSRMRKQK
23946RRSRMRKQ
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the shoot meristem during vegetative to reproductive phase transition. {ECO:0000269|PubMed:22319055}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250|UniProtKB:O65683, ECO:0000269|PubMed:29348240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00013267001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534851e-164AK353485.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-P17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623036.11e-122PREDICTED: ocs element-binding factor 1-like
SwissprotQ9SI158e-90BZIP2_ARATH; bZIP transcription factor 2
TrEMBLA0A078G6561e-121A0A078G656_BRANA; BnaC06g01290D protein
STRINGBo3g093980.11e-121(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.14e-91basic leucine-zipper 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]