PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00009986001
Common NameGSBRNA2T00009986001, LOC106380672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 177aa    MW: 20501 Da    PI: 10.1374
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00009986001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.9e-4161136277
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          Cqv++C+a+l+eak+y+rrhkvCevh+ka++++vsg +qrfCqqCsrfhel efDe+krsCr rLa+hnerrrk +
  GSBRNA2T00009986001  61 CQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAKRSCRMRLAGHNERRRKVS 136
                          *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.64158135IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.0E-3258122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-3759139IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MEKSQRWSYV KDKAIVSNLA EQEWENSMDG EEEDAGDEDK RKRMMERARG TNTDRVPPRL  60
CQVHRCTANL TEAKQYYRRH KVCEVHAKAS AATVSGAKQR FCQQCSRFHE LPEFDEAKRS  120
CRMRLAGHNE RRRKVSGDSF GERSGRRGFS GQLIQTQERN KVDIKFPMAN TSFKRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3859134984squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00009986001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037141e-163BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186111e-163AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429601e-163AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116101e-163AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675932.11e-130PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7582e-96SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078G6791e-130A0A078G679_BRANA; BnaA01g28740D protein
STRINGBra021094.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.18e-84squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]