PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00009408001
Common NameGSBRNA2T00009407001, GSBRNA2T00009408001, LOC106418227, LOC106430551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 108aa    MW: 13054.6 Da    PI: 10.1453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00009408001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.95.5e-093372445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                         +T++E++l+ + +++ G + W++Ia +++ gR ++++  +w 
  GSBRNA2T00009408001 33 MTEQEEDLIFRMHRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72
                         7****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.3E-62977IPR001005SANT/Myb domain
CDDcd001672.32E-63271No hitNo description
PfamPF002492.4E-83372IPR001005SANT/Myb domain
PROSITE profilePS500906.2843471IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.5E-113472IPR009057Homeodomain-like
SuperFamilySSF466891.17E-73472IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MDNTDRRRRR KQHKATLHDS EEVSSIEWEF INMTEQEEDL IFRMHRLVGD RWDLIAGRVP  60
GRQPEEIERY WIMRNSDGFA EKRRQLHHSS SHKSTKPHRP RFSIYPS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.133141e-179seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00009408001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1882111e-172KF188211.1 Brassica villosa BVTRY-1 (BVTRY-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714345.11e-74PREDICTED: transcription factor TRY
RefseqXP_013726794.11e-74PREDICTED: transcription factor TRY
SwissprotQ8GV052e-69TRY_ARATH; Transcription factor TRY
TrEMBLA0A078G3V41e-74A0A078G3V4_BRANA; BnaC09g29430D protein
STRINGfgenesh1_pg.C_scaffold_80013507e-68(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.13e-61MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]