PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00006850001
Common NameGSBRNA2T00006850001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TCP
Protein Properties Length: 306aa    MW: 32230.6 Da    PI: 8.0127
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00006850001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.96.2e-3772152383
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                          +k+++++++h kv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  +++ +ss++
  GSBRNA2T00006850001  72 PKRSSNKDRHIKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASALASAAAVSSHH 152
                          6999****************************************************************8874444444443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-3076152IPR005333Transcription factor, TCP
PROSITE profilePS5136927.2877131IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDPKNPNRHQ VPNFLNPPPR HQSIGDASKD DNHHHSKPAE VKDFQIVVAS DKEPNISKKP  60
QQQQQQQNQL GPKRSSNKDR HIKVEGRGRR IRMPALCAAR IFQLTRELGH KSDGETIQWL  120
LQQAEPSIIA ATGSGTIPAS ALASAAAVSS HHLQGGSLTA GLMISHELDG GGGSSSGRPN  180
WGVGGGDGVG GASRSSLPTG LWPNVAGFGA GVQTTGMMSD GGAMSFASIL GGGNNNQMPG  240
LELGLAQEGN VGVLNPHSFA QIYQQQMSQA QAQGRVLHHT LLHNPSHEEH QQESGEKDDS  300
QGSGR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00006850001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013672567.11e-179transcription factor TCP20-like
SwissprotQ9LSD51e-129TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A078ITM00.0A0A078ITM0_BRANA; BnaC07g49020D protein
STRINGBo7g084120.11e-173(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40502759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-115TCP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  3. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  4. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  5. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  6. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  7. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  8. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]