PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00006750001
Common NameGSBRNA2T00006750001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 170aa    MW: 18770.8 Da    PI: 4.0245
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00006750001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57365.99.2e-21105153250
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvs 50 
                          +fqrlw+e+Dei++LqG+idfk++tg sp+dd++a y+++kksisf+  
  GSBRNA2T00006750001 105 AFQRLWTEDDEIAVLQGMIDFKKDTGNSPYDDTNAYYDYIKKSISFEEF 153
                          69*******************************************9855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-14106157IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MTKKRNPLEN PPAASSSDDD DDEADSSAGE EEEEVNDSSS EEEEEEDQPN PPPSSSATDS  60
ESDTKKDKSP PPATKPGTKR PSEGTSKEAN SKRAKIGEDS KKPAAFQRLW TEDDEIAVLQ  120
GMIDFKKDTG NSPYDDTNAY YDYIKKSISF EEFEEEVYGQ REAFFHQAS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.130564e-91microspore| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105150.12e-68PREDICTED: mediator-associated protein 1
TrEMBLA0A078ITC81e-117A0A078ITC8_BRANA; BnaA01g36220D protein
STRINGBra031402.1-P7e-68(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-25DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]