PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00005865001
Common NameGSBRNA2T00005865001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 358aa    MW: 40322.9 Da    PI: 7.6953
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00005865001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.78.8e-39118210298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lfqrlwseeDei lLqG+idf+++tgksp++d+d+fyef+kksisf++sk q veKir+L+kK+ kkv++   g   s+ k+hd ++f+l
  GSBRNA2T00005865001 118 LFQRLWSEEDEIYLLQGMIDFNSETGKSPYEDMDGFYEFIKKSISFEASKYQTVEKIRSLRKKYVKKVRR---GV-ESLPKAHDMECFKL 203
                          79********************************************************************...55.49************ PP

               DUF573  92 skkiWgs 98 
                          sk iWgs
  GSBRNA2T00005865001 204 SKYIWGS 210
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.8E-31119209IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAKKKLNPLE DPPKSSSSDD EVETLSGEEE EEEEEAEEHI SDDSSSEEED DLMDPVIIPP  60
ARKPKSPARH AVASGSKKLT AVTVASPSKP GSKRSSEEIS PKKVHAKRSK KEDSKKPLFQ  120
RLWSEEDEIY LLQGMIDFNS ETGKSPYEDM DGFYEFIKKS ISFEASKYQT VEKIRSLRKK  180
YVKKVRRGVE SLPKAHDMEC FKLSKYIWGS NGMALKSNLK KKIDSVKPHG KEVEKDVESY  240
GSLKKKLDFL EANEGRRRLR GLGKKVEVDK EVLVNGDSKS VGVMSASDWF EDSFLVGSIA  300
SLGVGERFVK QKWSMVAVET KKKMEEKWKL LQAKEMELVL QKTDFMREVG SVIAEAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243257KKKLDFLEANEGRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00005865001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631638.11e-122PREDICTED: mediator-associated protein 1-like
TrEMBLA0A078G1690.0A0A078G169_BRANA; BnaC08g08690D protein
STRINGBra032717.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-66DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]