PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004587001
Common NameGSBRNA2T00004587001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 169aa    MW: 19423.2 Da    PI: 9.7318
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004587001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.55.2e-1274135263
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+ +r +rk +NRe+ArrsR +K++ +ee +    +L++eN++L ++l     +++  k+e+
  GSBRNA2T00004587001  74 KDERRNKRKKSNRESARRSRIKKQKHLEEVRSQLNQLKTENRDLLNRLRYFMHNCQHAKMES 135
                          7789***************************************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-967129No hitNo description
SMARTSM003384.1E-1373137IPR004827Basic-leucine zipper domain
PfamPF001703.4E-974134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5375138IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.47E-977128No hitNo description
CDDcd147021.02E-1478122No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSSIFPVFSS EPGTCSALES GLTPWNHASD IFSMFDSPVC PVEVNPGLEK TNSCPIQTKN  60
NPNPGSEDTH LPDKDERRNK RKKSNRESAR RSRIKKQKHL EEVRSQLNQL KTENRDLLNR  120
LRYFMHNCQH AKMESDRLRL EHKVLLDKLL NLRQALVLSP AELNMCMR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00004587001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022572835.11e-101bZIP transcription factor 44-like
RefseqXP_022573491.11e-101bZIP transcription factor 44-like
TrEMBLA0A078ISE01e-120A0A078ISE0_BRANA; BnaCnng21630D protein
TrEMBLA0A0D3BEM11e-120A0A0D3BEM1_BRAOL; Uncharacterized protein
TrEMBLA0A3P6AQD81e-120A0A3P6AQD8_BRAOL; Uncharacterized protein
STRINGBo3g097630.11e-121(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.11e-32basic leucine-zipper 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]