PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00002726001
Common NameGSBRNA2T00002726001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 270aa    MW: 30657.1 Da    PI: 7.1893
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00002726001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.44.7e-16181237258
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le eN++L ke+ee + e +k
  GSBRNA2T00002726001 181 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLERENEQLLKEIEEKTRERYK 237
                          5789********************************************998777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000418.0E-5729IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1706.6E-13179240No hitNo description
PRINTSPR000418.0E-5179195IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.4E-12180245IPR004827Basic-leucine zipper domain
PfamPF001701.0E-14181239IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.208182234IPR004827Basic-leucine zipper domain
CDDcd147073.71E-16184230No hitNo description
SuperFamilySSF579596.19E-10184235No hitNo description
PROSITE patternPS000360187202IPR004827Basic-leucine zipper domain
PRINTSPR000418.0E-5197217IPR001630cAMP response element binding (CREB) protein
PRINTSPR000418.0E-5217234IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASFKMMSSS TSRNSDLSRR NSSSASSSPT VRSNHLRRDP HADHSKITFA YGGGNDATLH  60
DYNFASDSLD VDRSNGDRNS VNGGGRKSVD DVWKEIVSGE KKTVLKEEAQ DEYMMTLEDF  120
LAQAAEMNGN DDEIDVKIPM SPSGTFDYPM MPQQQHNQVE MVEVSTRRKR GRVMVEAMDK  180
AAAQRQKRMI KNRESAARSR ERKQAYQVEL ETLAAKLERE NEQLLKEIEE KTRERYKNLM  240
EQLIPVDDEK RKPSSSASRS LSRSHSLEW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.139000.0seed
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00002726001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638560.11e-173PREDICTED: G-box-binding factor 4
SwissprotP427771e-110GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A078FZJ90.0A0A078FZJ9_BRANA; BnaC05g02200D protein
STRINGBo5g004230.11e-172(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-100G-box binding factor 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]