PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00001878001
Common NameGSBRNA2T00001878001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 573aa    MW: 62396.6 Da    PI: 6.0082
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00001878001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4462.6e-1362075671374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset.seknsseelaalklfsevsP 89 
                          lv++L++cAeav+s++l+la+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +t  +++ s++l++   f+e++P
  GSBRNA2T00001878001 207 LVHALMACAEAVQSSNLTLAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQTqIDHSLSDTLQM--HFYETCP 286
                          689****************************************************........444444043445555444..5****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          +lkf+h+taNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpps+R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++
  GSBRNA2T00001878001 287 YLKFAHFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPSFRLTGIGPPAADNSDHLHEVGCKLAQLAEAIHVEFEYR 376
                          ****************************************************************************************** PP

                 GRAS 180 vlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           +va++l+dl+ ++L+++p   Ea+aVn+v++lh+ll +++ +e+    v  +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+l
  GSBRNA2T00001878001 377 GFVANSLADLDASMLELRPseTEAVAVNSVFELHKLLGRTGGIEK----VFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTL 462
                          ******************9999***************99999999....***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fdsle      s++++++++++lg++i+n+vaceg +r+erhetl++W++r++++GF p++l+++a kqa++ll+ ++ ++gyrve+++g
  GSBRNA2T00001878001 463 FDSLEGA---PSSQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHLGSNAFKQASTLLALFNgGEGYRVEKNNG 549
                          ****999...79999*************************************************************************** PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                          +l+l W++rpL+++SaW+
  GSBRNA2T00001878001 550 CLMLSWHTRPLITTSAWK 567
                          *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011298.2E-3942115No hitNo description
PfamPF120414.8E-3342109IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098565.723181546IPR005202Transcription factor GRAS
PfamPF035149.1E-134207567IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MKRDLHQFQG PNHGTSIAGS STSSPAVFGK DKMMMVKEEE DDELLGVLGY KVRSSEMAEV  60
ALKLEQLETM MGNAQEDGLA HLATDTVHYN PAELYSWLDN MLTELNPPAA TTGSNALNPE  120
INNNNNNSFF TGGDLKAIPG NAVCRRSNQF AFAVDSSSNK RLKPSSSPDS MVTSPSPAGV  180
IGTTVTTVTE STRPLILVDS QDNGVRLVHA LMACAEAVQS SNLTLAEALV KQIGFLAVSQ  240
AGAMRKVATY FAEALARRIY RLSPPQTQID HSLSDTLQMH FYETCPYLKF AHFTANQAIL  300
EAFEGKKRVH VIDFSMNQGL QWPALMQALA LREGGPPSFR LTGIGPPAAD NSDHLHEVGC  360
KLAQLAEAIH VEFEYRGFVA NSLADLDASM LELRPSETEA VAVNSVFELH KLLGRTGGIE  420
KVFGVVKQIK PVIFTVVEQE SNHNGPVFLD RFTESLHYYS TLFDSLEGAP SSQDKVMSEV  480
YLGKQICNLV ACEGPDRVER HETLSQWSNR FGSSGFAPAH LGSNAFKQAS TLLALFNGGE  540
GYRVEKNNGC LMLSWHTRPL ITTSAWKLSA VH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-552075674375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.76630.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00001878001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9285490.0AY928549.1 Brassica rapa DELLA protein (RGA1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009101333.10.0PREDICTED: DELLA protein RGA1
RefseqXP_013684839.10.0PREDICTED: DELLA protein RGA1
SwissprotQ5BN230.0RGA1_BRACM; DELLA protein RGA1
TrEMBLA0A078FY140.0A0A078FY14_BRANA; BnaA06g34810D protein
STRINGBra024875.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]