PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00000614001
Common NameGSBRNA2T00000614001, LOC106452141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 347aa    MW: 39477.6 Da    PI: 8.2142
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00000614001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.31.4e-12264315556
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                          +r+rr++kNRe+A rsR+R++a++ eLe +  +L++eN +Lkk +ee +k+ 
  GSBRNA2T00000614001 264 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENLKLKKIVEENEKKR 315
                          79****************************************9999988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-9257323IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714262314IPR004827Basic-leucine zipper domain
PfamPF001702.2E-11264316IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-11264315No hitNo description
SuperFamilySSF579591.56E-9264313No hitNo description
PROSITE patternPS000360267282IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MHVHITRFIG LKTMPGLESE TSTFHVFNHD LQTQLQRYPQ ETAVEEHPPV GRQNSIMSLT  60
LDEIQMKSGK SFGAMNMDEL LANMWMTVEE NNGGGAGAQQ DGEKPTIVPR QGSLSVPVPL  120
YKKTVEEVWF EIQNGVQQPP PSSIAGQNPD EDNRRQQTLG EITLEDFLVK AGVVQEPLKT  180
TMKMSSSDFG YNPEFGVGLH CQTQNNYGDN RTGFNENRPF YSGMGESSSC MTGKERSDQY  240
LPGLNAFRIQ KRIIDGPPEI LMERRQRRMI KNRESAARSR ARRQAYTVEL ELELNQLTEE  300
NLKLKKIVEE NEKKRRQEVM NRSTQITKEK NGDKLRRIRR MASAGW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.26380.0seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00000614001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013749622.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform X1
SwissprotQ8RYD60.0AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A078F5L60.0A0A078F5L6_BRANA; BnaC03g54810D protein
TrEMBLA0A3P6BFV10.0A0A3P6BFV1_BRAOL; Uncharacterized protein
STRINGBo3g122120.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.11e-169bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]