PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00000377001
Common NameGSBRNA2T00000377001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 154aa    MW: 17834.8 Da    PI: 6.0305
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00000377001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-1278122347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+ E+  ++++  ++G g+Wk+++r+  k+R++ q+ s+ qky
  GSBRNA2T00000377001  78 PWTAKEHGEFLKGLDEFGRGDWKSVSRKYVKTRSARQVASHAQKY 122
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-969126IPR009057Homeodomain-like
PROSITE profilePS5129416.00971127IPR017930Myb domain
SuperFamilySSF466895.62E-1473126IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-1474126IPR006447Myb domain, plants
SMARTSM007172.9E-775125IPR001005SANT/Myb domain
PfamPF002491.7E-978122IPR001005SANT/Myb domain
CDDcd001676.90E-778123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MFEDALVLTE IDPNRFETIA SYLEMPLEVV KHHYDALVHD VELIESGRYG TTDYQDHADG  60
ILSPETKHME KDKKRGRPWT AKEHGEFLKG LDEFGRGDWK SVSRKYVKTR SARQVASHAQ  120
KYFQRQDMEN HAKKRSSIHD MTLVDDNDVD VNE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00000377001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146821.12e-98PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A078F6701e-112A0A078F670_BRANA; BnaA05g28230D protein
STRINGBra029856.1-P8e-99(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17289711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.12e-42MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]