PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00000265001
Common NameGSBRNA2T00000265001, LOC106412766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 352aa    MW: 40205.9 Da    PI: 8.6294
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00000265001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.42.8e-16950243
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         + +n+  r +t+ kRr g+ KK +E+S+LCd+++++i+fs++
  GSBRNA2T00000265001  9 FMKNEKSRAITLKKRRSGLVKKVKEISTLCDVKACLIMFSPK 50
                         67899***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-19159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.133150IPR002100Transcription factor, MADS-box
CDDcd002668.37E-25184No hitNo description
PRINTSPR004041.3E-8222IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-20393IPR002100Transcription factor, MADS-box
PfamPF003194.3E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-82237IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-83758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MTKKVKLAFM KNEKSRAITL KKRRSGLVKK VKEISTLCDV KACLIMFSPK EAEPMVWPSA  60
EAARNLLKDF DALPAFTKKK NETSLESYLK EKTWKVHESL RKKTQKENME CMMDQLKVQL  120
SSFPKLDDLD VKEIYSLISL SKDAIMHLRK KIGSVQHCPL RDPPVYPFEE QVKEFRTTTG  180
GGQEYERARK TYEEVNMASI GASKEKQTYY LMDEWIFPSL KQPSPQTHQQ IMMNMASYNN  240
NTLNPRCYQS YHPYQGSNSN GNHNMEMAPA FPPALAFPDF VGPVSDPHPY DFMRHEERSN  300
IDNNNNANNI GFWPETPPPA NGATAEEGIV GASSFDISYL MDYPGIKNHH F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00000265001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0116220.0AP011622.1 Brassica rapa subsp. pekinensis DNA, chromosome: Linkage group A5, BAC clone: KBrB038I07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018514239.10.0PREDICTED: MADS-box transcription factor 18-like
TrEMBLA0A078F9N50.0A0A078F9N5_BRANA; BnaA05g27290D protein
STRINGBra034809.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.13e-76AGAMOUS-like 48
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]