PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g26240.1.p
Common NameBRADI_5g26240, LOC100825377
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 218aa    MW: 22370.5 Da    PI: 7.3687
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g26240.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.51.1e-363694260
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                      +++ ++cprC s ntkfCyynnys++qPr+fC+aCrryWt+GG+lrnvPvGg++r++ +
  Bradi5g26240.1.p 36 QQQLVECPRCGSGNTKFCYYNNYSTAQPRHFCRACRRYWTHGGSLRNVPVGGACRRRDA 94
                      68899**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.7E-323893IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-224091IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.9134094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MAPDAAATGK LPDQAPPLLA QGDHHQAGAG NGNGKQQQLV ECPRCGSGNT KFCYYNNYST  60
AQPRHFCRAC RRYWTHGGSL RNVPVGGACR RRDAAASGNA NKRRRASSSD SGYPSSSSAE  120
PPSSAAQDQL PPPALTFPFL SDGTAFFLPP PPQYDISLGA GSAAAAFSWP LYDGGLGAAP  180
WDDGTLSGAA AGAATGAWGN VDEFTGLDLS WPPASGN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
189104RRRDAAASGNANKRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g26240.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126208e-43CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580828.11e-155dof zinc finger protein DOF1.7
TrEMBLI1J3D71e-154I1J3D7_BRADI; Uncharacterized protein
STRINGBRADI5G26240.11e-155(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-28Dof family protein