PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g25320.2.p
Common NameBRADI_5g25320, LOC100827834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 415aa    MW: 44826.6 Da    PI: 6.5482
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g25320.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32224278155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWt+eLHerFv++v++LGG+++AtPk il+lm+ +gLt++h+kSHLQkYR+
  Bradi5g25320.2.p 224 KTRIRWTQELHERFVDCVSKLGGADRATPKGILKLMNSDGLTIYHIKSHLQKYRT 278
                       68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.267221281IPR017930Myb domain
SuperFamilySSF466891.77E-17222278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-29223278IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-24224278IPR006447Myb domain, plants
PfamPF002492.6E-9228277IPR001005SANT/Myb domain
PfamPF143798.2E-22313359IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MMDARKMKLH GRHQYCSGMM PAPAPRLMAP AASAYGSAGG FHHGFSSPAA LHHQQQIQQQ  60
QQHGGGWLQD PDQYAAVAPS CVVGSDTAMF YAAEKLLGMP QLDCCPPLRM LPPHMPLELD  120
HPAVMTYYVR PQQRRGDGAD LPLTPQQQQG EGVQLNHGLY GNGSAIKPHS FVPAAMDLQA  180
PSGSLQMGQM TDSSHGHMPR SCVGAPASHT SNGSLAAPAP APSKTRIRWT QELHERFVDC  240
VSKLGGADRA TPKGILKLMN SDGLTIYHIK SHLQKYRTVK CVPSSSSSSE GKQQEKRAAG  300
SDDVPNLDPK TGMHITEALR VQLDVQRRLH EQLEIQRKLQ VRIEEQGKRL QEMFEEQLKA  360
SGNAAAAAPG SPEPGCAASD DVVIFPVSDD EDEDDDVQLL SVASSSYDED LLAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-22224280157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-22224280157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-22224280157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-22224280157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g25320.2.p
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3643321e-116AK364332.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2023N07.
GenBankAK3709621e-116AK370962.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2121B01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240570.10.0protein PHR1-LIKE 1
RefseqXP_014750960.10.0protein PHR1-LIKE 1
TrEMBLI1J3320.0I1J332_BRADI; Uncharacterized protein
STRINGBRADI5G25320.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-54G2-like family protein