PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g21010.1.p
Common NameBRADI_5g21010, LOC100820977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 391aa    MW: 42686.6 Da    PI: 4.7553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g21010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-5051321128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppG+rFhPtd el v+yLk+k+ g++l++ ++++++d+yk+ Pw+Lp k +++++++ewyfF+ rd+ky++g+r+nr+t++gyWkatgkd++
  Bradi5g21010.1.p   5 LPPGYRFHPTDVELTVYYLKRKLLGRPLRC-NAVTDIDLYKFAPWELPeKaSLQTGDREWYFFCMRDRKYSSGSRTNRSTEAGYWKATGKDRA 96 
                       79****************************.89**************95347788999*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v++ k+++vg+k+tLvf++g+ p+g++tdWvm eyrl
  Bradi5g21010.1.p  97 VIH-KNQTVGMKRTLVFHSGKPPQGTRTDWVMYEYRL 132
                       ***.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-613155IPR003441NAC domain
PROSITE profilePS5100556.4525155IPR003441NAC domain
PfamPF023653.8E-266132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MATSLPPGYR FHPTDVELTV YYLKRKLLGR PLRCNAVTDI DLYKFAPWEL PEKASLQTGD  60
REWYFFCMRD RKYSSGSRTN RSTEAGYWKA TGKDRAVIHK NQTVGMKRTL VFHSGKPPQG  120
TRTDWVMYEY RLVDKDISSS DVKLDNCVLC KIFKKSGAGP KIGEQYGAPF NEEEWNDLNG  180
APSVPHSAPG SSNGVLNSAG QQLPVSDDGE VSLSPLSENN VERAANCTRA DASFDSINIQ  240
QLADIIGRFS TKFSVTAGQA GALPDLTAKY DNETSYELQP DLTADHNKLS FDDETIFDEL  300
DKVPSGSVES ISKQCASCGG YLIEPMLEPV EGEQYFELND LLSSLADGHP GPSCLVASND  360
ASHECHLDLE LNGISKSSTT SAVAAGPLPC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-54416116171NO APICAL MERISTEM PROTEIN
1ut4_B8e-54416116171NO APICAL MERISTEM PROTEIN
1ut7_A8e-54416116171NO APICAL MERISTEM PROTEIN
1ut7_B8e-54416116171NO APICAL MERISTEM PROTEIN
3swm_A8e-54416119174NAC domain-containing protein 19
3swm_B8e-54416119174NAC domain-containing protein 19
3swm_C8e-54416119174NAC domain-containing protein 19
3swm_D8e-54416119174NAC domain-containing protein 19
3swp_A8e-54416119174NAC domain-containing protein 19
3swp_B8e-54416119174NAC domain-containing protein 19
3swp_C8e-54416119174NAC domain-containing protein 19
3swp_D8e-54416119174NAC domain-containing protein 19
4dul_A8e-54416116171NAC domain-containing protein 19
4dul_B8e-54416116171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g21010.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581627.10.0NAC domain-containing protein 102
SwissprotQ84K002e-72NAC78_ARATH; NAC domain-containing protein 78
TrEMBLI1J1J60.0I1J1J6_BRADI; Uncharacterized protein
STRINGBRADI5G21010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148561721
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.17e-75NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]