PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g20520.1.p
Common NameBRADI_5g20520, LOC100839058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 267aa    MW: 29589.6 Da    PI: 9.0084
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g20520.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.6e-332377155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      k+rlrWtpeLH+rFv+av++LGG++kAtPk++l+lm++kgLtl h+kSHLQkYR+
  Bradi5g20520.1.p 23 KQRLRWTPELHRRFVDAVAKLGGPDKATPKSVLRLMGIKGLTLFHLKSHLQKYRM 77
                      79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.7372080IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-312078IPR009057Homeodomain-like
SuperFamilySSF466896.81E-172378IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-242377IPR006447Myb domain, plants
PfamPF002491.2E-92576IPR001005SANT/Myb domain
PfamPF143791.0E-21122165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MFEGSYGGGC AAGAEAALSR DPKQRLRWTP ELHRRFVDAV AKLGGPDKAT PKSVLRLMGI  60
KGLTLFHLKS HLQKYRMGRQ TKKATDLELA SSGGFAAGDI SFSIGTPRLV PAGDDNREIS  120
PTDTLRYQIQ VQRKLHEQLE VQKKLHARIE AQGRYLKAIL EKAKKNISVD INGSPNIEST  180
RSQFMDFNLD LLGLMDNGTQ MYEENSEQLM KAISDNNLKD NNLDFQLYDV GSQEAKNVRC  240
TPRTEDLLLL DLNIKGGHDL SSTGMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-212379157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-212379157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-212379157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-212379157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g20520.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580464.20.0LOW QUALITY PROTEIN: myb family transcription factor PHL11
TrEMBLI1J1D60.0I1J1D6_BRADI; Uncharacterized protein
STRINGBRADI5G20520.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.17e-57G2-like family protein