PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g20340.1.p
Common NameBRADI_5g20340, LOC100829666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LFY
Protein Properties Length: 398aa    MW: 43178.2 Da    PI: 9.4735
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g20340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY5309e-16213841386
           FLO_LFY   1 mdpea..fsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmk 91 
                       mdp++  ++a+ f+wd  + a ap+ +l +     ++     +a a  + releel+++yGvr +tva+i+elGft+stL+ m+d+eldd+++
  Bradi5g20340.1.p   1 MDPNDafLAAHPFRWDLGPPAPAPAPSL-PPP---PP--PPPQAPALPAPRELEELVSGYGVRASTVARISELGFTASTLLVMTDRELDDMTA 87 
                       777665346779****654332232222.222...12..233455666799****************************************** PP

           FLO_LFY  92 slseifrldllvGeryGikaavraerrrleeeeaekkrrkll.sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekksee 183
                       +l+ +fr+dll+Ger+G++aa+raer rl++  +++  +  l  +++ +++d +sqe+ls+e++      +g g+e    + +va +++++  
  Bradi5g20340.1.p  88 ALAGLFRWDLLIGERFGLRAALRAERSRLMSPPNAAPGTCRLhGHHSLSTVDGASQEVLSNERDGVASGGMGEGEEA--GRMMVAGKKQRNGL 178
                       ******************************96655555555614555569************886543333332222..23333333233333 PP

           FLO_LFY 184 ekkkaskkkqkrkk.kkelkse..ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiaker 273
                         +k +k++ ++k   +el+ +  e+ed  ++e+++++ +g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq++ak +
  Bradi5g20340.1.p 179 AGRKGKKARMRKKVgGDELRLDvqEEEDGGRSESTESSAGGVGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQVQSMAKLH 271
                       333333333333320223333343555556667777777899999************************************************ PP

           FLO_LFY 274 GekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLs 366
                       G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde  s+alrra+k+rgenvGawrqacy+plv+i+ar+g+didavf+ahprL+
  Bradi5g20340.1.p 272 GQKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEAGSDALRRAYKARGENVGAWRQACYAPLVDISARHGFDIDAVFAAHPRLA 364
                       ********************************************************************************************* PP

           FLO_LFY 367 iWYvPtkLrqLChlerskas 386
                       iWYvPt+Lr LCh++rs+++
  Bradi5g20340.1.p 365 IWYVPTRLRLLCHQARSAHA 384
                       ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.3E-1891384IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDPNDAFLAA HPFRWDLGPP APAPAPSLPP PPPPPPQAPA LPAPRELEEL VSGYGVRAST  60
VARISELGFT ASTLLVMTDR ELDDMTAALA GLFRWDLLIG ERFGLRAALR AERSRLMSPP  120
NAAPGTCRLH GHHSLSTVDG ASQEVLSNER DGVASGGMGE GEEAGRMMVA GKKQRNGLAG  180
RKGKKARMRK KVGGDELRLD VQEEEDGGRS ESTESSAGGV GGGERQREHP FVVTEPGEVA  240
RAKKNGLDYL FHLYEQCRLF LLQVQSMAKL HGQKSPTKVT NQVFRYAKKV GASYINKPKM  300
RHYVHCYALH CLDEAGSDAL RRAYKARGEN VGAWRQACYA PLVDISARHG FDIDAVFAAH  360
PRLAIWYVPT RLRLLCHQAR SAHAHASAAA LPPPPMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-962223812161PROTEIN LEAFY
2vy2_A1e-962223812161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g20340.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2318880.0AB231888.1 Triticum aestivum WFLa mRNA for FLORICAULA/LEAFY-like protein, complete cds.
GenBankAB2318900.0AB231890.1 Triticum aestivum WFLd mRNA for FLORICAULA/LFAFY-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580435.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLI1J1B60.0I1J1B6_BRADI; Uncharacterized protein
STRINGBRADI5G20340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-114floral meristem identity control protein LEAFY (LFY)