PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g19190.1.p
Common NameBRADI_5g19190, LOC100838548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 632aa    MW: 66831.6 Da    PI: 8.4107
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g19190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3151.7e-962646312374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL e+A a+++g+le a a La+l+  ++p+gd+ +Rl a+++ AL++r+a + s ++k ++         se+ +  +l++++sP+++f+
  Bradi5g19190.1.p 264 RQLLSEAAVAMADGNLETAAAHLATLKGAVNPRGDAEHRLLAMMVAALSSRIAPTASATSKHIAD-----LCGSEHRTGSQLLHDISPCFRFA 351
                       689***************************************************44444443333.....33667777889************ PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlva 183
                         +aN aI+eav+  ++vH +Dfdis + Q +aL+q La+R+ +  sl++T+v +p+s      + +l ++g rL+k+Ae+ g++ +f++ v 
  Bradi5g19190.1.p 352 LHAANIAIVEAVADRRAVHLVDFDISVP-QHVALIQCLADRRVPGTSLKVTAVTDPTSPftesLTATLDAVGARLKKLAERAGIEYRFKI-VN 442
                       **************************98.99************************9988888778899*********************9.68 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        r ++++ ++L ++pgEalaVnl+++l r++desvs +++rde+L+ v++l P+vv++veqe++ n++++++rf++a+ +y a+++sl+a+++
  Bradi5g19190.1.p 443 CRAAEIDSSKLGCEPGEALAVNLAFALSRVPDESVSPANPRDELLRRVRGLGPRVVTLVEQELNSNTAPLATRFTDACAHYGAILESLDATAG 535
                       899****************************************************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s +r+  E++ +++++ n+v  ega+r er+e ++kWr+r+++aGF+pv+l   +a+q+k+ + + +  g+ v+ e+g l lgW++r +++
  Bradi5g19190.1.p 536 RDSADRARAEEA-VANKAANAVGREGADRLERCEVFGKWRARFGMAGFRPVALAAGIADQVKARVGNSQ-PGFAVKPENGVLRLGWMGRVITV 626
                       ************.9999**************************************************99.9********************** PP

              GRAS 370 vSaWr 374
                       +SaWr
  Bradi5g19190.1.p 627 ASAWR 631
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.293237612IPR005202Transcription factor GRAS
PfamPF035145.8E-94264631IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MEQPGGPWRD PRQGYLYGVG SAMQTPLQQQ QQQRRRPDTA AVGGVLKRSL GEIERWQHQR  60
QVAMQQELYM RAVRQRTAVA SAISPLSSAD IAKVLGRGSS QPLVLSGSSL GGNLASPSST  120
LSSLTTASRA AIPLIQPQLH RQVPFVPSSE HALGVTRAPA PSATGSELSI LQELEKQLLF  180
DDDDEAEPAM SGTGSAVTSS EWEETMMIQQ LNPITAAPSP FPGVAAPNNN NINKGMTRSP  240
SNSSTSTASS SASCSPPTSA TTSRQLLSEA AVAMADGNLE TAAAHLATLK GAVNPRGDAE  300
HRLLAMMVAA LSSRIAPTAS ATSKHIADLC GSEHRTGSQL LHDISPCFRF ALHAANIAIV  360
EAVADRRAVH LVDFDISVPQ HVALIQCLAD RRVPGTSLKV TAVTDPTSPF TESLTATLDA  420
VGARLKKLAE RAGIEYRFKI VNCRAAEIDS SKLGCEPGEA LAVNLAFALS RVPDESVSPA  480
NPRDELLRRV RGLGPRVVTL VEQELNSNTA PLATRFTDAC AHYGAILESL DATAGRDSAD  540
RARAEEAVAN KAANAVGREG ADRLERCEVF GKWRARFGMA GFRPVALAAG IADQVKARVG  600
NSQPGFAVKP ENGVLRLGWM GRVITVASAW R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-392596311375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLI1J0W50.0I1J0W5_BRADI; Uncharacterized protein
STRINGBRADI5G19190.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-79SCARECROW-like 8