PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g18640.1.p
Common NameBRADI_5g18640, LOC100828153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 380aa    MW: 39063.4 Da    PI: 8.5861
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g18640.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3976137263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Bradi5g18640.1.p  76 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 137
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2770124IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3378134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05980134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDAAHWHQGL GLLKPMEEML MGTTNQQQVQ GSNPNLIPPP PSSSPAPGAG GGAMGLVAGA  60
VVAGVGSSER KARPQKEKAL NCPRCNSTNT KFCYYNNYSL QQPRYFCKTC RRYWTEGGSL  120
RNVPVGGGSR KNKRSSSSSS ANAASGVSAS TSIMASSTSM ASKNPKLAHH HEGGGAQHDL  180
NLSFPHHGLH GGMQQQAADQ YMAFPSLESS SIGGAMASGN NGRHGPGAGP LSAMELLRST  240
GCYMPSLHVP MQMPPAAPGE YGAAAVQGFS LGEFRAAPGP AQSQSSQSLL GFSLDAHHGG  300
TVGMQGMPQD RAGRMLFPFE DLKPTDASGA GSGAGVENGG RHQYEQAGKE QGDGGTGSHA  360
GHDTAPGFWN GMIGGGTSW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g18640.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9654939e-87EU965493.1 Zea mays clone 286416 dof zinc finger protein mRNA, complete cds.
GenBankKC5824139e-87KC582413.1 Sorghum bicolor dof20 protein (dof20) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580343.10.0dof zinc finger protein 1
SwissprotQ9SXG81e-103DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLA0A0Q3ECG50.0A0A0Q3ECG5_BRADI; Uncharacterized protein
STRINGBRADI5G18640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.13e-33Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]