PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g18590.1.p
Common NameBRADI_5g18590, LOC100827236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 292aa    MW: 31403.7 Da    PI: 8.7949
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g18590.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.8e-281871255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      pr++Wt eLH rF++a+e LGG++ AtPk +l+lm+v+gLt++hvkSHLQ+ Rl
  Bradi5g18590.1.p 18 PRMKWTAELHGRFLKAIEWLGGQDYATPKLVLQLMGVNGLTISHVKSHLQMLRL 71
                      8***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.0831474IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-261475IPR009057Homeodomain-like
SuperFamilySSF466895.02E-141672IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-211871IPR006447Myb domain, plants
PfamPF002491.7E-71969IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGGGKKEAVR QYVRSKVPRM KWTAELHGRF LKAIEWLGGQ DYATPKLVLQ LMGVNGLTIS  60
HVKSHLQMLR LTCARTGTGM KEIQPQLQRK HSCGADEKGP KAFMCPPLER TRTGTEATSK  120
GMQGSQGISE MRTPGTQYCI DDYMPALAME RRIKEEGLRW QRDTATAASS LQTVGCLEQG  180
SGDFKIIKPE ARHPGPPVVT KQGHKANNVN GCFLFSSAAS TDDQDGTPEQ CSLSLSLGQY  240
PKCFRSVSSS PSEGSCIISS SPRSSGDCYG HSACSNAPGV NLELSLSICG S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-141970354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-141970354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-141970354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-141970354Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g18590.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240272.10.0uncharacterized protein LOC100827236
TrEMBLI1J0P10.0I1J0P1_BRADI; Uncharacterized protein
STRINGBRADI5G18590.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-25G2-like family protein