PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17722.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 384aa    MW: 40411.9 Da    PI: 9.9345
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17722.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.39.8e-24113165153
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                       +CqvegC+  l+ akeyhrrhkvCe+hskap v+v+g eqrfCqqCsr h ++
  Bradi5g17722.3.p 113 RCQVEGCHLALAGAKEYHRRHKVCEAHSKAPRVVVHGAEQRFCQQCSRAHGVT 165
                       6*************************************************875 PP

2SBP44.83.4e-141782124377
                       -TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP  43 CqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       C    rfh++sefD++krsCrrrLa+hnerrrk++
  Bradi5g17722.3.p 178 CVCKCRFHAMSEFDDAKRSCRRRLAGHNERRRKSN 212
                       55557****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-25108165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.436111211IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-22112164IPR004333Transcription factor, SBP-box
PfamPF031103.9E-20114166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-11178214IPR004333Transcription factor, SBP-box
PfamPF031104.1E-7182210IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MEGDGGAGHR ATAPWDLGMQ WAPPPATSAY PQHFMPPPPP AAMASAQRQQ QELTSLKLGK  60
RPCYLPGWRD GQLAQVGAAG HVDVNGGRRA VAAPEGKRKE KAAAATATAA VARCQVEGCH  120
LALAGAKEYH RRHKVCEAHS KAPRVVVHGA EQRFCQQCSR AHGVTVYMIV RSMRVAGCVC  180
KCRFHAMSEF DDAKRSCRRR LAGHNERRRK SNASEAMARG SAHTHGVTSL VHLFAPYGAL  240
LPASPAGALS LLSSARAAGA TPWQLIPTAP DAFPAGRSSS AALDELIAEN RAALLACHFF  300
PDRSGRGAES VPGSWQHAHA APPPAPAGHV TLDLMQAPTA GGLLRPTMRT PDRASSRPAE  360
DIPDDEAGRG PGVWAPLQGA HVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-25105210284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g17722.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542387e-60BT054238.1 Zea mays full-length cDNA clone ZM_BFb0189E24 mRNA, complete cds.
GenBankBT0546547e-60BT054654.2 Zea mays full-length cDNA clone ZM_BFb0036O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581504.20.0squamosa promoter-binding-like protein 7
SwissprotQ01JD17e-95SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLA0A2K2CHW40.0A0A2K2CHW4_BRADI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-30SBP family protein