PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17722.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 389aa    MW: 41814.8 Da    PI: 11.949
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17722.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP76.54.2e-24113163151
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEE CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhe 51 
                       +CqvegC+  l+ akeyhrrhkvCe+hskap v+v+g eqrfCqqCsr h 
  Bradi5g17722.2.p 113 RCQVEGCHLALAGAKEYHRRHKVCEAHSKAPRVVVHGAEQRFCQQCSRSHV 163
                       6************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-25108163IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.298111188IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-22112164IPR004333Transcription factor, SBP-box
PfamPF031102.2E-19114164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEGDGGAGHR ATAPWDLGMQ WAPPPATSAY PQHFMPPPPP AAMASAQRQQ QELTSLKLGK  60
RPCYLPGWRD GQLAQVGAAG HVDVNGGRRA VAAPEGKRKE KAAAATATAA VARCQVEGCH  120
LALAGAKEYH RRHKVCEAHS KAPRVVVHGA EQRFCQQCSR SHVAGAPFRA VRRPAARFPG  180
WCSLSSVIGQ SRRRHALAAD PDGARRVPRR PLQQRRPRRA HRREPRRPPR VPLLPRPLRP  240
GCGVGARQLA ARARGASAGS SGPRDAGPHA GPHRGRAAQA HHAHAGQGLQ QASRGYTRRR  300
SGPRPGRVGA PAGSPCGLTC WGLGSSPVLG YTMHARRRRQ VVACFVPEIY FVPWARLEPA  360
LFWSLCRPCN ISINLSWDSV IYSSCSGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-15114163655squamosa promoter-binding protein-like 12
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g17722.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542382e-60BT054238.1 Zea mays full-length cDNA clone ZM_BFb0189E24 mRNA, complete cds.
GenBankBT0546542e-60BT054654.2 Zea mays full-length cDNA clone ZM_BFb0036O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K2CHW20.0A0A2K2CHW2_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.46e-19squamosa promoter binding protein-like 10