PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g17150.1.p
Common NameBRADI_5g17150, LOC100838968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Trihelix
Protein Properties Length: 759aa    MW: 81886.1 Da    PI: 6.5234
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g17150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.27e-3187171187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+++e+laLi++r+em+ ++r++ lk+plWeevs+k++e g++r++k+Ckek+en++k+yk++keg+ +r++++s  +++f++lea
  Bradi5g17150.1.p  87 RWPREETLALIRIRSEMDATFRDATLKGPLWEEVSRKLAELGYKRNAKKCKEKFENVHKYYKRTKEGRTGRQDGKS--YRFFSELEA 171
                       8*********************************************************************866665..******985 PP

2trihelix112.42.6e-35498583187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r +m++r++++  k+plWee+s+ mr+ g++r+pk+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+qlea
  Bradi5g17150.1.p 498 RWPKTEVHALIQLRMDMDNRYQENGPKGPLWEEISSGMRRLGYNRNPKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLEA 583
                       8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00184146IPR001005SANT/Myb domain
PfamPF138376.5E-2286172No hitNo description
PROSITE profilePS500906.9886144IPR017877Myb-like domain
CDDcd122031.26E-3086151No hitNo description
SMARTSM007170.002495557IPR001005SANT/Myb domain
PROSITE profilePS500907.236497555IPR017877Myb-like domain
PfamPF138374.6E-23497584No hitNo description
Gene3DG3DSA:1.10.10.605.8E-4497554IPR009057Homeodomain-like
CDDcd122031.00E-30497562No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MQQHQGGGSQ YGAPPPQDMG PFSTAPPAPG PVPLSSRPPA PTQQQQPTYE ELAAASGAGA  60
GSGGFPDDDM LGGDNSGGGL GASGGNRWPR EETLALIRIR SEMDATFRDA TLKGPLWEEV  120
SRKLAELGYK RNAKKCKEKF ENVHKYYKRT KEGRTGRQDG KSYRFFSELE ALHATTTAQH  180
HQEQQLPPVS SAAAPPQLQH AFAAPAVSAP LPMSTMPPPP GPIQPAPISS AAPAAHVAEL  240
HQAPPPLGLQ GLSFPSMSES ESDDESEDDE MTAETGGGSG SQDGLGKRKH GGSKKLMAFF  300
EGLMKQVIQR QEEMQRRFLE TMEKREAERM AREEAWRKQE VARLNREQEI LAHERAAAAS  360
RDASIIAFLQ RVGAGQAVQV PAPVVIPMPA PMQVQTPRQP PRQQLPPPPP PAQATAPPPQ  420
PIPAAPLQQQ PPPPQPQHKE TTMARQEAVT TPRSAPTPTP TPASGGTSLA LVPVSEQQVE  480
SHGLGGGGDH GGAASSSRWP KTEVHALIQL RMDMDNRYQE NGPKGPLWEE ISSGMRRLGY  540
NRNPKRCKEK WENINKYFKK VKESNKRRPE DSKTCPYFHQ LEAIYRKKHN GAGAAAAVSA  600
ANAAAVASVC AVTTDQQQSL SLNRHEIEGK KINDNDKRNN GGVGGATQTQ VPTSNGETTP  660
TTTPPLDFSE KKPEDTVREL SEQQQHREFT TDETDSDDMG DDYTDGEDGE DDGKMQYRIQ  720
FQTPNPVGTN NAPPPATTQT TAVPPTSTPS SSFLAMVQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137KRNAKKCKE
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g17150.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240190.10.0trihelix transcription factor GTL1 isoform X1
SwissprotQ391172e-72TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLI1J0640.0I1J064_BRADI; Uncharacterized protein
STRINGBRADI5G17150.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-48Trihelix family protein