PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g16917.1.p
Common NameBRADI_5g16917, SWN2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 335aa    MW: 38201 Da    PI: 6.8722
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g16917.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.72.7e-5471361129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv++yL+kkv+ k+++l ++ik+vd+yk+ePwd+++  k+ + ++++w+fFs++dkky+tg+r+nrat++g+Wkatg+dk
  Bradi5g16917.1.p   7 VPPGFRFHPTDEELVDYYLRKKVAFKSIDL-DIIKDVDLYKIEPWDIQEqcKIGTeDQNDWFFFSHKDKKYPTGTRTNRATTAGFWKATGRDK 98 
                       69****************************.99**************953444442455********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       ++++ k+ lvg++ktLvfykgrap+g+k+dW+mheyrle
  Bradi5g16917.1.p  99 PIYV-KHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                       ****.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-595156IPR003441NAC domain
PROSITE profilePS5100557.737156IPR003441NAC domain
PfamPF023656.0E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRKKVA FKSIDLDIIK DVDLYKIEPW DIQEQCKIGT  60
EDQNDWFFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YVKHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETSEN GAPHDEGWVV CKVFKKRVAT VQRMSTDSPF WVNDHVAFVA  180
PHVDSPRQAM HHLQNALYNG HQQSYYNHHP CKVELEYHHL LPQEPMSFLQ LPQLESPRLP  240
DLIGAVATLQ QPSILTRHGD QASSQQLQID PVYATDASAA ADWRDLDKFM ASQLISHGES  300
NLAKAFQVEQ GKQEEALDYV STSASGGGGN DLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-48615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934230.0JQ693423.1 Brachypodium distachyon SWN2 (SWN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266823.10.0uncharacterized protein LOC100845863
RefseqXP_010239582.10.0PREDICTED: uncharacterized protein LOC100845863 isoform X1
SwissprotQ9FWX21e-121NAC7_ARATH; NAC domain-containing protein 7
TrEMBLI1J0390.0I1J039_BRADI; SWN2
STRINGBRADI5G16917.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-112NAC 007
Publications ? help Back to Top
  1. Valdivia ER, et al.
    Regulation of secondary wall synthesis and cell death by NAC transcription factors in the monocot Brachypodium distachyon.
    J. Exp. Bot., 2013. 64(5): p. 1333-43
    [PMID:23386682]