PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g15587.1.p
Common NameBRADI_5g15587, LOC100840483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 289aa    MW: 32197 Da    PI: 5.4139
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g15587.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.3e-51101371128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF P+d+elv++yL kkv++++ +   ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev 
  Bradi5g15587.1.p  10 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVR 101
                       79*************************888.78***************77777889************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +  ++++vg++ktLvfy+grap+g+kt+Wvmhe+rl
  Bradi5g15587.1.p 102 NPsTRAVVGMRKTLVFYQGRAPNGTKTSWVMHEFRL 137
                       9867778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-598156IPR003441NAC domain
PROSITE profilePS5100558.1810156IPR003441NAC domain
PfamPF023654.0E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD QELVCHYLYK KVTNERASQG TLVEVDLHAR EPWELPDVAK  60
LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RNPSTRAVVG MRKTLVFYQG  120
RAPNGTKTSW VMHEFRLDTP HLPPREDWVL CRVFEKQKGD GEQDNISASS PAFAGSSQAA  180
AAQEPHQPML DTSNDQIMGS AMGFVPRQDQ EEVCGSNYPL LNAAMWQQYS SVLDTFPLQE  240
EIMVGSSPMM GLGAARSGAG DDCGFLFDSG FDDVANFGAG MRFPQGWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5011574166NO APICAL MERISTEM PROTEIN
1ut4_B4e-5011574166NO APICAL MERISTEM PROTEIN
1ut7_A4e-5011574166NO APICAL MERISTEM PROTEIN
1ut7_B4e-5011574166NO APICAL MERISTEM PROTEIN
3swm_A4e-5011577169NAC domain-containing protein 19
3swm_B4e-5011577169NAC domain-containing protein 19
3swm_C4e-5011577169NAC domain-containing protein 19
3swm_D4e-5011577169NAC domain-containing protein 19
3swp_A4e-5011577169NAC domain-containing protein 19
3swp_B4e-5011577169NAC domain-containing protein 19
3swp_C4e-5011577169NAC domain-containing protein 19
3swp_D4e-5011577169NAC domain-containing protein 19
4dul_A4e-5011574166NAC domain-containing protein 19
4dul_B4e-5011574166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g15587.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484800.0AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580130.10.0protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FRV48e-62NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLI1IZM60.0I1IZM6_BRADI; Uncharacterized protein
STRINGBRADI5G15587.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-81NAC domain containing protein 74
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Shinohara N,Ohbayashi I,Sugiyama M
    Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration.
    Front Plant Sci, 2014. 5: p. 159
    [PMID:24808900]
  3. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  4. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  5. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  6. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  7. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  8. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]