PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g12338.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 636aa    MW: 71998.7 Da    PI: 6.6098
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g12338.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.15.8e-1062536242373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAeav+s+d++ a+++L++++  +sp+gd+ qRla+yf+++L+arla+++s+ y++l  ++ts   + + ++a++l+s ++ ++k++
  Bradi5g12338.1.p 253 ETLLIRCAEAVASNDHRSASEVLEKIKRYSSPTGDSRQRLAHYFAQGLEARLAGTGSQFYRSLIGTRTS---TMKLVQAYHLYSATFCFFKVA 342
                       789************************************************************888887...6888899************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +l  N++I++av+g +++Hi+ ++i+ G+QWp L+q La+R++gpp++R+T +++p++g   +e++ee g+rL+++A+++g++f+fn+ ++ +
  Bradi5g12338.1.p 343 FLFSNKTIYKAVAGRKKLHIVHYGINIGVQWPELIQWLADREGGPPEVRMTSISKPQPGfrPSEQIEEAGHRLSNYASKFGMSFKFNA-ITAQ 434
                       ****************************************************************************************.6889 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        e+++ e+++++p+E+l+Vn+ +q ++l+des++++   +rd vL+++++++P v+v++  + +++++ F++rf +al+ ++++fd le+++p
  Bradi5g12338.1.p 435 PEAVRAEDIHIDPDEVLVVNSLFQFKTLMDESLTMDRvsPRDMVLNTIRKMKPSVFVHAITNGSYSAAFFMTRFRHALYNFASFFDVLETTIP 527
                       *********************************999888****************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r++++r k+Er +++r+++n+vacega+r+er +++++W+ r ++aG++++pl+ +++   k  +++ + + ++++e++ +l++gWk+r L++
  Bradi5g12338.1.p 528 RNNDKRLKMERDFFARSVMNMVACEGADRVERPQNYREWQTRNHRAGLRQLPLDPDIVLMLKDKVKNQYHKHFMINEDHRWLLQGWKGRVLYA 620
                       *********************************************************************999********************* PP

              GRAS 370 vSaW 373
                       +SaW
  Bradi5g12338.1.p 621 LSAW 624
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.172226605IPR005202Transcription factor GRAS
PfamPF035142.0E-103253624IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MAATQEELLG VIESAPVHPS VFLDHGDSKQ PQDDLSLEYI SRMLMEDDIV DKFTYQYTDH  60
PKLLQVEQPF AQILSAADTT SFDGDESSAL PDVLASALLP SKVQDPAFFS NGTGTVEPRN  120
DEFPMESASI TSMNKMPSTE FFKGMENTEM FLPRDFVMVD SRGCKNKFDV DGVTEAGMGR  180
SSKQIAVLVH ADSEEEDELK KSLDCLILNG YDRHPGEMQE LLITPDKENK VAQKSRRIRG  240
RRGATQTVVT DLETLLIRCA EAVASNDHRS ASEVLEKIKR YSSPTGDSRQ RLAHYFAQGL  300
EARLAGTGSQ FYRSLIGTRT STMKLVQAYH LYSATFCFFK VAFLFSNKTI YKAVAGRKKL  360
HIVHYGINIG VQWPELIQWL ADREGGPPEV RMTSISKPQP GFRPSEQIEE AGHRLSNYAS  420
KFGMSFKFNA ITAQPEAVRA EDIHIDPDEV LVVNSLFQFK TLMDESLTMD RVSPRDMVLN  480
TIRKMKPSVF VHAITNGSYS AAFFMTRFRH ALYNFASFFD VLETTIPRNN DKRLKMERDF  540
FARSVMNMVA CEGADRVERP QNYREWQTRN HRAGLRQLPL DPDIVLMLKD KVKNQYHKHF  600
MINEDHRWLL QGWKGRVLYA LSAWVADDAS SSNVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-442566248374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581312.20.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A0Q3EH360.0A0A0Q3EH36_BRADI; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-131SCARECROW-like 14