PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g11270.1.p
Common NameBRADI_5g11270, LOC100829055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23289.9 Da    PI: 8.2186
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g11270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.22.5e-241058250
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      rien   rqvtf+kRr g+lKKA+ELSvLC+a++ vi++s++gk+ye +
  Bradi5g11270.1.p 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCEADIGVIVISPHGKIYELA 58
                      8*********************************************965 PP

2K-box60.85.6e-2177173499
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                       ++ +s +++k +  qqe+  L++ei+ Lq+ +R + Ge d++ ++l eLq Le++Le  + ++Rs+K++++ ++ie l++ke  l+ +n +L+
  Bradi5g11270.1.p  77 AQAESSNQNKPQVIQQEVLLLRQEIDLLQKGLRYMYGEkDINHMNLDELQALESNLEIWVHNVRSTKMQIISREIEMLKNKEGILKAANDMLQ 169
                       45566788999**************************868***************************************************** PP

             K-box  96 kkle 99 
                       +++ 
  Bradi5g11270.1.p 170 ERII 173
                       9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.273161IPR002100Transcription factor, MADS-box
SMARTSM004327.1E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-26175IPR002100Transcription factor, MADS-box
CDDcd002656.14E-34274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-221056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-243859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2481172IPR002487Transcription factor, K-box
PROSITE profilePS5129713.44187179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCE ADIGVIVISP HGKIYELATN  60
GNMGSLIERY KGSNTEAQAE SSNQNKPQVI QQEVLLLRQE IDLLQKGLRY MYGEKDINHM  120
NLDELQALES NLEIWVHNVR STKMQIISRE IEMLKNKEGI LKAANDMLQE RIIEQSGILG  180
TSSDTLIPQF PFHRNMESDY YF*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi5g11270.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693300.0KF469330.1 Brachypodium distachyon MADS-box transcription factor 36 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288322.11e-149MADS-box transcription factor 26-like
SwissprotA2YQK97e-78MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G87e-78MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLI1IY591e-147I1IY59_BRADI; MADS-box transcription factor 36
STRINGBRADI5G11270.11e-148(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.15e-57AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Wei B, et al.
    Genome-wide analysis of the MADS-box gene family in Brachypodium distachyon.
    PLoS ONE, 2014. 9(1): p. e84781
    [PMID:24454749]
  4. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]