PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g10640.1.p
Common NameBRADI_5g10640, LOC100840174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 200aa    MW: 22335.8 Da    PI: 6.5974
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g10640.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.35.6e-3171241128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGf+F P+deel+v++L++k++  +++  ++++++  ++++Pw+L+ k+ +  ++wyfFs++ +        +r+ ++g W+  g d++v 
  Bradi5g10640.1.p   7 LPPGFHFFPSDEELIVHFLRRKASLLPCRP-DIVPTLPPNRYDPWELNGKALEAGNQWYFFSHSTQ--------SRTSQNGQWNPIGADEAVS 90 
                       79*************************999.89**************966667789******9754........577889************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +g+++glkk ++f  g+  +++kt+Wvmhey+l
  Bradi5g10640.1.p  91 S-GGRNIGLKKKFIFSIGEPFQSNKTNWVMHEYHL 124
                       9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-434162IPR003441NAC domain
PROSITE profilePS5100539.7447163IPR003441NAC domain
PfamPF023651.5E-208124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGGASNLPPG FHFFPSDEEL IVHFLRRKAS LLPCRPDIVP TLPPNRYDPW ELNGKALEAG  60
NQWYFFSHST QSRTSQNGQW NPIGADEAVS SGGRNIGLKK KFIFSIGEPF QSNKTNWVMH  120
EYHLLDGNGG SSTSSSSGKR SHKKKGHSNK ESSNWVICRV FESSCHSQVS FHEDDMELSC  180
LDEVFLSLDD YDEVSLPKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-32616816170NAC domain-containing protein 19
4dul_A5e-32616816170NAC domain-containing protein 19
1ut7_B5e-32616816170NO APICAL MERISTEM PROTEIN
1ut7_A5e-32616816170NO APICAL MERISTEM PROTEIN
1ut4_B5e-32616816170NO APICAL MERISTEM PROTEIN
1ut4_A5e-32616816170NO APICAL MERISTEM PROTEIN
3swp_D6e-32616819173NAC domain-containing protein 19
3swp_C6e-32616819173NAC domain-containing protein 19
3swp_B6e-32616819173NAC domain-containing protein 19
3swp_A6e-32616819173NAC domain-containing protein 19
3swm_D6e-32616819173NAC domain-containing protein 19
3swm_C6e-32616819173NAC domain-containing protein 19
3swm_B6e-32616819173NAC domain-containing protein 19
3swm_A6e-32616819173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579793.11e-148PREDICTED: NAC transcription factor NAM-1
SwissprotQ8GWK61e-62NC104_ARATH; NAC domain-containing protein 104
TrEMBLI1IXY01e-148I1IXY0_BRADI; Uncharacterized protein
STRINGBRADI5G10640.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP45101024
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.16e-62xylem NAC domain 1