PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g02880.1.p
Common NameBRADI_5g02880, LOC100844745
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TCP
Protein Properties Length: 178aa    MW: 18371.8 Da    PI: 5.7546
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g02880.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP107.81.6e-3353122372
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                       ++ +r+s++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ s++++
  Bradi5g02880.1.p  53 PRARRSSDRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVSPEEA 122
                       6889***********************************************************8887743 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136924.71758112IPR017887Transcription factor TCP subgroup
PfamPF036342.1E-2658119IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MMSSSPSELV LYNLVPTQTL NPTAAPPPPP PTNDPAADLS IATATPAAST GRPRARRSSD  60
RHAKVAGRGR RVRIPAMVAA RVFQLTRELG HRTDGETIEW LLRQAEPSII AATGTGVSPE  120
EAPPAAVPIG SAAAVQGAPF VQVPYYTALL MQPPTADEPP VAPADASASV TVAEENN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925361e-118FP092536.1 Phyllostachys edulis cDNA clone: bphylf049m10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581062.11e-121PREDICTED: transcription factor PCF1-like
SwissprotO238754e-69PCF1_ORYSJ; Transcription factor PCF1
TrEMBLA0A0Q3E6C71e-121A0A0Q3E6C7_BRADI; Uncharacterized protein
STRINGBRADI5G02880.11e-120(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9221459
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.11e-32TCP family protein