PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g45224.2.p
Common NameBRADI_4g45224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 227aa    MW: 23905.2 Da    PI: 8.7531
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g45224.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof108.24.3e-34463261
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                      + ++++cprC+s +tkfCyynny++ qPry C++C+ryWt GGalrnvPvG g+r+++k+
  Bradi4g45224.2.p  4 PAQNIECPRCHSLDTKFCYYNNYNVLQPRYHCRGCERYWTVGGALRNVPVGVGCRNRNKR 63
                      67899**************************************************87765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-20263IPR003851Zinc finger, Dof-type
PfamPF027011.8E-28662IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.114862IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101046IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
RPQPAQNIEC PRCHSLDTKF CYYNNYNVLQ PRYHCRGCER YWTVGGALRN VPVGVGCRNR  60
NKRPAASSSR AKLPVAPAAP PASTSMSMSM ADFPNFISSP PPAGIGMLHS QNKAGIGMAM  120
PLPPLSFGIG GTTPMMQPTA AFQCGDQGGG SINNMSVMSL PMSTMGLDWQ PQLNGVNGGA  180
QQLGVTAAMD ISNTTNGGEG SSRGCYLINN NNGGLWQSLM NDSSLM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15762RNRNKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g45224.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024310784.11e-167dof zinc finger protein DOF1.6 isoform X2
TrEMBLA0A2K2CUD81e-164A0A2K2CUD8_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5036522
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-27TARGET OF MONOPTEROS 6