PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g45222.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 321aa    MW: 34060.3 Da    PI: 6.3848
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g45222.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof108.43.6e-3458112761
            zf-Dof   7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +cprC+s +tkfCyynnys++qPry C++CrryWt+GGalrnvPvGgg+r++ +s
  Bradi4g45222.2.p  58 ECPRCHSGDTKFCYYNNYSITQPRYHCRGCRRYWTQGGALRNVPVGGGCRNRSSS 112
                       7*************************************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2045107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.96257111IPR003851Zinc finger, Dof-type
PfamPF027018.0E-3058110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
CAPCRLASPL LYMYHPLLGF LVLLLLPLRE CAFASHETEE AGMATNGRQG AAARLRPECP  60
RCHSGDTKFC YYNNYSITQP RYHCRGCRRY WTQGGALRNV PVGGGCRNRS SSTKQRSSGN  120
KIARSTVPLP DPAAASSSSG PTAMAASSMV NLIPTMLPAF VPPPGWGRDL VVPPTPSFLD  180
ILRSGGGLLP IDGAMPHRQN NTDYYADIGM AMPSFGGTAT VHQELAVGEE GAGDGGVGDM  240
PMPMPMAGLE WQPQLIGGVN GGIESSGFAQ QHLGAGEKNV TDNDKYIING GEGPSRDDYY  300
WIDDDNNGGG PWQGLTNNSQ *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g45222.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872622e-35BT087262.1 Zea mays full-length cDNA clone ZM_BFb0021J09 mRNA, complete cds.
GenBankEU9665492e-35EU966549.1 Zea mays clone 295206 dof domain, zinc finger family protein mRNA, complete cds.
GenBankJX4284772e-35JX428477.1 Zea mays subsp. mays clone pUT3073 DOF20 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024310444.10.0dof zinc finger protein DOF1.6-like
TrEMBLA0A2K2CUC10.0A0A2K2CUC1_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-29Dof family protein