PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g44930.2.p
Common NameBRADI_4g44930, LOC100823409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 299aa    MW: 32795.4 Da    PI: 8.3242
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g44930.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.2e-3159112255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH +F++av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  Bradi4g44930.2.p  59 PRLRWTPELHLCFLRAVQRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 112
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.06355115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2955113IPR009057Homeodomain-like
SuperFamilySSF466891.7E-1556113IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-2458113IPR006447Myb domain, plants
PfamPF002491.5E-960111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDIIGTSKGN GGGSSSNDDI SSSTVEEGGG HHHDDQDTKA GDLSTSSTSV RPYVRSKNPR  60
LRWTPELHLC FLRAVQRLGG QDRATPKLVL QLMNVRGLSI GHVKSHLQMY RSKRIDDSGQ  120
IIGGHISFPR AFHHGQSGAV TMLSRFGTTP WRSSFHEQPP WLHGHQHFPG SKPYYSFSSA  180
AQAGQHLARG AASSSNPDQL MMQLGRTPSP NDHYTMNHHQ QQKRLEPQST VENSDDVHAP  240
LDLDLSLGVA MPRQETKRRR SAGCIWVKDG NVGKISGDEE EEDESTATML SLSLFSRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-1860114357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-1860114357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-1860114357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-1860114357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g44930.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0379577e-81BT037957.1 Zea mays full-length cDNA clone ZM_BFb0204N03 mRNA, complete cds.
GenBankBT0684407e-81BT068440.1 Zea mays full-length cDNA clone ZM_BFb0191O11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577159.10.0transcription factor NIGT1 isoform X2
TrEMBLI1IV760.0I1IV76_BRADI; Uncharacterized protein
STRINGBRADI4G44930.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.15e-41G2-like family protein