PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43995.1.p
Common NameBRADI_4g43995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 434aa    MW: 46534.1 Da    PI: 4.6082
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43995.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.61.1e-48191461128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdee++v+yL +kv    + + ++++ vdiy++eP+dLp++++ +ekewyfF+++  ky+t++r+nratk+gyWk+tg+dk+++
  Bradi4g43995.1.p  19 LPPGFRFHPTDEEVIVHYLLPKVLYPAFAC-RAVTVVDIYSCEPRDLPSEARMGEKEWYFFVPKGLKYPTSSRANRATKEGYWKSTGRDKDIF 110
                       79*************************999.88***************988999*************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        + ++el+g+kk+Lvfy grap g+ktdWvmhe+rl
  Bradi4g43995.1.p 111 GEcTRELIGMKKSLVFYMGRAPAGVKTDWVMHEFRL 146
                       9988889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-5812171IPR003441NAC domain
PROSITE profilePS5100554.63319171IPR003441NAC domain
PfamPF023651.1E-2520146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MLSSKQHDGG RVAGGGLSLP PGFRFHPTDE EVIVHYLLPK VLYPAFACRA VTVVDIYSCE  60
PRDLPSEARM GEKEWYFFVP KGLKYPTSSR ANRATKEGYW KSTGRDKDIF GECTRELIGM  120
KKSLVFYMGR APAGVKTDWV MHEFRLHGRT RDWVIVNGQK DEWVVCKVFN KGEWEADSNP  180
LENPDSVGAD ELDVGASGEL DLSGVEGYDL ELDSIPELDQ ELLDYIKDLD PFTSYQLNEN  240
HQLPEANTTT NAGTIDALPP YNMGCYSYTV PTTAGMPSFV VNPTGMIMPS LTNNVNVAIS  300
SIHQSANATT MAASSVPGSS NGAGAGSSWN VRQNLPNYGV GLGRSFFNGI SLQEEQAVMA  360
DALGGLLSGA GPSSGVTPTM GSLLPSSAAA IASLPSPQQS TMEIYNDGGY PSYGVYAPDV  420
AAGAAKDFGG RLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-471717115165NO APICAL MERISTEM PROTEIN
1ut4_B2e-471717115165NO APICAL MERISTEM PROTEIN
1ut7_A2e-471717115165NO APICAL MERISTEM PROTEIN
1ut7_B2e-471717115165NO APICAL MERISTEM PROTEIN
3swm_A3e-471717118168NAC domain-containing protein 19
3swm_B3e-471717118168NAC domain-containing protein 19
3swm_C3e-471717118168NAC domain-containing protein 19
3swm_D3e-471717118168NAC domain-containing protein 19
3swp_A3e-471717118168NAC domain-containing protein 19
3swp_B3e-471717118168NAC domain-containing protein 19
3swp_C3e-471717118168NAC domain-containing protein 19
3swp_D3e-471717118168NAC domain-containing protein 19
4dul_A2e-471717115165NAC domain-containing protein 19
4dul_B2e-471717115165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815GGRVAGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi4g43995.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024318518.10.0NAC domain-containing protein 77-like
TrEMBLA0A0Q3EYP30.0A0A0Q3EYP3_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51203063
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.12e-62NAC family protein