PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43020.1.p
Common NameBRADI_4g43020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 361aa    MW: 39502.9 Da    PI: 4.1886
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM64.82.5e-20221515128
               NAM   5 frFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +rF+ +  e v++yL + ++g+ l+ +e  i+++diy ++eP+dL +    + kae++ + +fF+  ++++ + +r+ r++  g+W  + +d 
  Bradi4g43020.1.p  22 CRFDLNPLEAVTYYLPRLLSGEALHGAERlIHRADIYgNLEPEDLAAafppAPKAERTgDRFFFTLCKRQKGSRTRSARSAGGGTWTIQTTDD 114
                       58888899***************7776655******9456*****8446763333434478**************************998877 PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        v +  g +vg  k L f kg +++ ++t Wvm+ey+ 
  Bradi4g43020.1.p 115 VVDH-AGVKVGEVKHLSFKKGIKKDKTSTGWVMEEYHC 151
                       6666.999*************99999**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.39718171IPR003441NAC domain
PfamPF023653.4E-1022150IPR003441NAC domain
SuperFamilySSF1019416.02E-2223170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
QSTYRRSGLE MDHADDEVFQ LCRFDLNPLE AVTYYLPRLL SGEALHGAER LIHRADIYGN  60
LEPEDLAAAF PPAPKAERTG DRFFFTLCKR QKGSRTRSAR SAGGGTWTIQ TTDDVVDHAG  120
VKVGEVKHLS FKKGIKKDKT STGWVMEEYH CLLPEAVVQD GEMVLCKIHL SLSAQKARRG  180
SAAHRSGSQE QEDQPAPMPV ATAKRPAPAA SDHDPPCAKR ARVDAQDEAT VEAAADYMDG  240
RFSCTMDELL GGATDEDQEE EAAALPAVEA EQQTVDFDLD LPVLDEDALS EIMLSLDEDD  300
APMSLPAVEA EQPIASDEDF DFEFPTAEEL NAMFSDVEDW PLNFAADGDF IRFPGLPAVL  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239527.10.0PREDICTED: uncharacterized protein LOC104585199
TrEMBLA0A0Q3HVP80.0A0A0Q3HVP8_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI4G43020.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9262314
MonocotsOGMP18322799
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.14e-11NAC domain containing protein 17